Roseobase: Phaeobacter gallaeciensis 2.10

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: PGA2:500000..600000, PGA2_c00030, PGA2_239p2120, argD, YP_006561290, tRNA-Leu, transposase, transcriptional regulator, PPHLDPTSAAAGAIDQVLYSNVFEGLTRFMGDGSVVPGLAQSWE.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 12 regions match your request.
Matches on PGA2
overview_PGA2
PGA2_c01840 putative transposase PGA2:207.5..207.7 kbp (213 bp) score=10
PGA2_c01850 putative transposase PGA2:207.7..207.9 kbp (207 bp) score=10
PGA2_c01860 transposase PGA2:208..208.3 kbp (297 bp) score=10
PGA2_c01870 transposase PGA2:208.5..208.7 kbp (243 bp) score=10
PGA2_c04550 transposase PGA2:498.6..499.6 kbp (1.035 kbp) score=10
PGA2_c06400 transposase PGA2:708.6..708.8 kbp (213 bp) score=10
PGA2_c06410 transposase PGA2:708.9..709.3 kbp (399 bp) score=10
PGA2_c23750 transposase PGA2:2.619..2.619 Mbp (267 bp) score=10
PGA2_c28680 putative transposase PGA2:3.149..3.149 Mbp (138 bp) score=10
PGA2_71p100 putative transposase PGA2:3.774..3.774 Mbp (351 bp) score=10
PGA2_239p1170 putative transposase PGA2:4.054..4.055 Mbp (219 bp) score=10
PGA2_239p1260 putative transposase PGA2:4.063..4.064 Mbp (835 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70