Roseobase: Phaeobacter gallaeciensis 2.10

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: PGA2:500000..600000, PGA2_c00030, PGA2_239p2120, argD, YP_006561290, tRNA-Leu, transposase, transcriptional regulator, PPHLDPTSAAAGAIDQVLYSNVFEGLTRFMGDGSVVPGLAQSWE.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 172 regions match your request.
Matches on PGA2
overview_PGA2
trnA1 tRNA-Ala PGA2:39..39.07 kbp (76 bp) score=10
trnA1 tRNA-Ala-TGC PGA2:39..39.07 kbp (76 bp) score=10
trnI1 tRNA-Ile-GAT PGA2:39.1..39.18 kbp (77 bp) score=10
trnI1 tRNA-Ile PGA2:39.1..39.18 kbp (77 bp) score=10
trnM1 tRNA-Met-CAT PGA2:42.79..42.87 kbp (77 bp) score=10
trnM1 tRNA-Met PGA2:42.79..42.87 kbp (77 bp) score=10
PGA2_c00730 peptidyl-tRNA hydrolase-like protein PGA2:79.81..80.25 kbp (432 bp) score=10
trnT1 tRNA-Thr PGA2:172.6..172.7 kbp (75 bp) score=10
trnT1 tRNA-Thr-GGT PGA2:172.6..172.7 kbp (75 bp) score=10
trnF tRNA-Phe-GAA PGA2:182..182.1 kbp (75 bp) score=10
trnF tRNA-Phe PGA2:182..182.1 kbp (75 bp) score=10
trnQ tRNA-Gln-TTG PGA2:258.4..258.5 kbp (75 bp) score=10
trnQ tRNA-Gln PGA2:258.4..258.5 kbp (75 bp) score=10
PGA2_c02720 tRNA threonylcarbamoyladenosine biosynthesis protein PGA2:306.2..307.1 kbp (948 bp) score=10
miaB (dimethylallyl)adenosine tRNA methylthiotransferase MiaB PGA2:466.1..467.4 kbp (1.323 kbp) score=10
trmB tRNA (guanine-N(7)-)-methyltransferase TrmB PGA2:475..475.7 kbp (765 bp) score=10
pth peptidyl-tRNA hydrolase Pth PGA2:484.5..485.3 kbp (759 bp) score=10
trnS1 tRNA-Ser PGA2:503.6..503.7 kbp (90 bp) score=10
trnS1 tRNA-Ser-GCT PGA2:503.6..503.7 kbp (90 bp) score=10
truA tRNA pseudouridine synthase A PGA2:582.1..582.9 kbp (774 bp) score=10
ileS isoleucyl-tRNA synthetase IleS PGA2:588.7..591.7 kbp (2.949 kbp) score=10
PGA2_c05520 tRNA(Ile)-lysidine synthase PGA2:613.2..614.4 kbp (1.161 kbp) score=10
glyQ glycyl-tRNA synthetase subunit alpha PGA2:667.1..668 kbp (930 bp) score=10
glyS glycyl-tRNA synthetase subunit beta PGA2:669.9..672 kbp (2.115 kbp) score=10
trnL1 tRNA-Leu PGA2:700.1..700.2 kbp (87 bp) score=10
trnL1 tRNA-Leu-GAG PGA2:700.1..700.2 kbp (87 bp) score=10
pheS phenylalanyl-tRNA synthetase subunit alpha PGA2:723.6..724.7 kbp (1.074 kbp) score=10
pheT phenylalanyl-tRNA synthetase subunit beta PGA2:725.7..728.1 kbp (2.397 kbp) score=10
trnT2 tRNA-Thr-TGT PGA2:798.5..798.5 kbp (76 bp) score=10
trnT2 tRNA-Thr PGA2:798.5..798.5 kbp (76 bp) score=10
trnS2 tRNA-Ser-TGA PGA2:872.9..873 kbp (90 bp) score=10
trnS2 tRNA-Ser PGA2:872.9..873 kbp (90 bp) score=10
metG methionyl-tRNA synthetase MetG PGA2:901.9..903.7 kbp (1.728 kbp) score=10
trnE1 tRNA-Glu PGA2:927.6..927.7 kbp (75 bp) score=10
trnE1 tRNA-Glu-TTC PGA2:927.6..927.7 kbp (75 bp) score=10
trnE2 tRNA-Glu-TTC PGA2:928.1..928.1 kbp (75 bp) score=10
trnE2 tRNA-Glu PGA2:928.1..928.1 kbp (75 bp) score=10
trnH tRNA-His-GTG PGA2:964.8..964.9 kbp (77 bp) score=10
trnH tRNA-His PGA2:964.8..964.9 kbp (77 bp) score=10
trnG1 tRNA-Gly-GCC PGA2:1.015..1.015 Mbp (75 bp) score=10
trnG1 tRNA-Gly PGA2:1.015..1.015 Mbp (75 bp) score=10
trnG2 tRNA-Gly PGA2:1.016..1.016 Mbp (75 bp) score=10
trnG2 tRNA-Gly-GCC PGA2:1.016..1.016 Mbp (75 bp) score=10
trnG3 tRNA-Gly PGA2:1.018..1.018 Mbp (75 bp) score=10
trnG3 tRNA-Gly-GCC PGA2:1.018..1.018 Mbp (75 bp) score=10
gatB aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B PGA2:1.073..1.075 Mbp (1.515 kbp) score=10
argS arginyl-tRNA synthetase ArgS PGA2:1.21..1.211 Mbp (1.746 kbp) score=10
trnP1 tRNA-Pro PGA2:1.217..1.217 Mbp (77 bp) score=10
trnP1 tRNA-Pro-GGG PGA2:1.217..1.217 Mbp (77 bp) score=10
tyrS tyrosyl-tRNA synthetase TyrS PGA2:1.231..1.232 Mbp (1.257 kbp) score=10
valS valyl-tRNA synthetase ValS PGA2:1.259..1.262 Mbp (3.084 kbp) score=10
trnL2 tRNA-Leu PGA2:1.279..1.279 Mbp (86 bp) score=10
trnL2 tRNA-Leu-TAA PGA2:1.279..1.279 Mbp (86 bp) score=10
selU tRNA 2-selenouridine synthase SelU PGA2:1.346..1.347 Mbp (1.062 kbp) score=10
aat leucyl/phenylalanyl-tRNA--protein transferase Aat PGA2:1.385..1.386 Mbp (633 bp) score=10
trnN1 tRNA-Asn PGA2:1.429..1.43 Mbp (75 bp) score=10
trnN1 tRNA-Asn-GTT PGA2:1.429..1.43 Mbp (75 bp) score=10
trnM2 tRNA-Met-CAT PGA2:1.449..1.449 Mbp (76 bp) score=10
trnM2 tRNA-Met PGA2:1.449..1.449 Mbp (76 bp) score=10
PGA2_c13870 threonyl/alanyl tRNA synthetase-like protein PGA2:1.527..1.528 Mbp (732 bp) score=10
trnS3 tRNA-Ser PGA2:1.528..1.528 Mbp (90 bp) score=10
trnS3 tRNA-Ser-GGA PGA2:1.528..1.528 Mbp (90 bp) score=10
miaA tRNA delta(2)-isopentenylpyrophosphate transferase MiaA PGA2:1.556..1.556 Mbp (873 bp) score=10
mnmA tRNA-specific 2-thiouridylase MnmA PGA2:1.569..1.571 Mbp (1.146 kbp) score=10
PGA2_c14300 glutamyl-tRNA synthetase PGA2:1.578..1.579 Mbp (876 bp) score=10
trmFO methylenetetrahydrofolate-tRNA-(uracil-5-)- methyltransferase PGA2:1.579..1.581 Mbp (1.344 kbp) score=10
dusB tRNA-dihydrouridine synthase DusB PGA2:1.617..1.618 Mbp (1.014 kbp) score=10
trmJ tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ PGA2:1.656..1.657 Mbp (747 bp) score=10
trnG4 tRNA-Gly-CCC PGA2:1.666..1.666 Mbp (74 bp) score=10
trnG4 tRNA-Gly PGA2:1.666..1.666 Mbp (74 bp) score=10
alaS alanyl-tRNA synthetase AlaS PGA2:1.677..1.68 Mbp (2.652 kbp) score=10
trnS4 tRNA-Ser-CGA PGA2:1.696..1.696 Mbp (90 bp) score=10
trnS4 tRNA-Ser PGA2:1.696..1.696 Mbp (90 bp) score=10
trnR1 tRNA-Arg PGA2:1.75..1.75 Mbp (77 bp) score=10
trnR1 tRNA-Arg-CCG PGA2:1.75..1.75 Mbp (77 bp) score=10
PGA2_c15930 tRNA-processing ribonuclease PGA2:1.755..1.756 Mbp (864 bp) score=10
trnL3 tRNA-Leu PGA2:1.782..1.782 Mbp (86 bp) score=10
trnL3 tRNA-Leu-CAA PGA2:1.782..1.782 Mbp (86 bp) score=10
cysS cysteinyl-tRNA synthetase PGA2:1.794..1.796 Mbp (1.398 kbp) score=10
trnN2 tRNA-Asn-GTT PGA2:1.821..1.821 Mbp (75 bp) score=10
trnN2 tRNA-Asn PGA2:1.821..1.821 Mbp (75 bp) score=10
trnP2 tRNA-Pro-TGG PGA2:1.838..1.838 Mbp (77 bp) score=10
trnP2 tRNA-Pro PGA2:1.838..1.838 Mbp (77 bp) score=10
gltX1 glutamyl-tRNA synthetase PGA2:1.857..1.859 Mbp (1.401 kbp) score=10
queA S-adenosylmethionine:tRNA ribosyltransferase-isomerase QueA PGA2:1.908..1.909 Mbp (1.071 kbp) score=10
trnL4 tRNA-Leu-TAG PGA2:1.97..1.97 Mbp (85 bp) score=10
trnL4 tRNA-Leu PGA2:1.97..1.97 Mbp (85 bp) score=10
serS seryl-tRNA synthetase SerS PGA2:1.998..1.999 Mbp (1.293 kbp) score=10
dusA tRNA-dihydrouridine synthase A PGA2:2.028..2.029 Mbp (1.032 kbp) score=10
PGA2_c19030 arginine-tRNA-protein transferase PGA2:2.11..2.111 Mbp (822 bp) score=10
trnD1 tRNA-Asp PGA2:2.14..2.14 Mbp (77 bp) score=10
trnD1 tRNA-Asp-GTC PGA2:2.14..2.14 Mbp (77 bp) score=10
trnD2 tRNA-Asp PGA2:2.14..2.14 Mbp (77 bp) score=10
trnD2 tRNA-Asp-GTC PGA2:2.14..2.14 Mbp (77 bp) score=10
trnD3 tRNA-Asp PGA2:2.14..2.14 Mbp (77 bp) score=10
trnD3 tRNA-Asp-GTC PGA2:2.14..2.14 Mbp (77 bp) score=10
trnV1 tRNA-Val PGA2:2.141..2.141 Mbp (76 bp) score=10
trnV1 tRNA-Val-TAC PGA2:2.141..2.141 Mbp (76 bp) score=10
trnV2 tRNA-Val PGA2:2.142..2.142 Mbp (75 bp) score=10
trnV2 tRNA-Val-CAC PGA2:2.142..2.142 Mbp (75 bp) score=10
tgt queuine tRNA-ribosyltransferase Tgt PGA2:2.151..2.152 Mbp (1.131 kbp) score=10
thrS threonyl-tRNA synthetase ThrS PGA2:2.196..2.198 Mbp (1.947 kbp) score=10
proS prolyl-tRNA synthetase ProS PGA2:2.248..2.25 Mbp (1.356 kbp) score=10
gatA glutamyl-tRNA(Gln) amidotransferase subunit A PGA2:2.307..2.309 Mbp (1.488 kbp) score=10
gatC aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C PGA2:2.309..2.309 Mbp (288 bp) score=10
tadA tRNA-specific adenosine deaminase TadA PGA2:2.311..2.311 Mbp (462 bp) score=10
dtd D-tyrosyl-tRNA(Tyr) deacylase Dtd PGA2:2.32..2.32 Mbp (447 bp) score=10
trnG5 tRNA-Gly-TCC PGA2:2.332..2.332 Mbp (74 bp) score=10
trnG5 tRNA-Gly PGA2:2.332..2.332 Mbp (74 bp) score=10
trnC tRNA-Cys-GCA PGA2:2.339..2.339 Mbp (74 bp) score=10
trnC tRNA-Cys PGA2:2.339..2.339 Mbp (74 bp) score=10
PGA2_c21980 tRNA-modifying protein ygfZ-like protein PGA2:2.436..2.437 Mbp (741 bp) score=10
aspS aspartyl-tRNA synthetase AspS PGA2:2.489..2.491 Mbp (1.779 kbp) score=10
trnM3 tRNA-Met-CAT PGA2:2.619..2.619 Mbp (77 bp) score=10
trnM3 tRNA-Met PGA2:2.619..2.619 Mbp (77 bp) score=10
trnI2 tRNA-Ile PGA2:2.623..2.623 Mbp (77 bp) score=10
trnI2 tRNA-Ile-GAT PGA2:2.623..2.623 Mbp (77 bp) score=10
trnA2 tRNA-Ala-TGC PGA2:2.623..2.623 Mbp (76 bp) score=10
trnA2 tRNA-Ala PGA2:2.623..2.623 Mbp (76 bp) score=10
trnR2 tRNA-Arg-TCT PGA2:2.643..2.643 Mbp (77 bp) score=10
trnR2 tRNA-Arg PGA2:2.643..2.643 Mbp (77 bp) score=10
PGA2_c24270 lysyl-tRNA synthetase PGA2:2.676..2.678 Mbp (1.644 kbp) score=10
gltX2 glutamyl-tRNA synthetase PGA2:2.697..2.698 Mbp (1.326 kbp) score=10
trpS tryptophanyl-tRNA synthetase TrpS PGA2:2.739..2.74 Mbp (1.029 kbp) score=10
trnM4 tRNA-Met PGA2:2.93..2.93 Mbp (77 bp) score=10
trnM4 tRNA-Met-CAT PGA2:2.93..2.93 Mbp (77 bp) score=10
trnI3 tRNA-Ile PGA2:2.934..2.934 Mbp (77 bp) score=10
trnI3 tRNA-Ile-GAT PGA2:2.934..2.934 Mbp (77 bp) score=10
trnA3 tRNA-Ala PGA2:2.934..2.934 Mbp (76 bp) score=10
trnA3 tRNA-Ala-TGC PGA2:2.934..2.934 Mbp (76 bp) score=10
PGA2_c26890 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC-like protein PGA2:2.973..2.974 Mbp (699 bp) score=10
trnP3 tRNA-Pro PGA2:3.057..3.057 Mbp (77 bp) score=10
trnP3 tRNA-Pro-CGG PGA2:3.057..3.057 Mbp (77 bp) score=10
PGA2_c27790 tRNA synthetase PGA2:3.058..3.06 Mbp (1.089 kbp) score=10
hisS histidyl-tRNA synthetase HisS PGA2:3.06..3.061 Mbp (1.488 kbp) score=10
trnM5 tRNA-Met PGA2:3.103..3.103 Mbp (77 bp) score=10
trnM5 tRNA-Met-CAT PGA2:3.103..3.103 Mbp (77 bp) score=10
trnA4 tRNA-Ala PGA2:3.127..3.127 Mbp (76 bp) score=10
trnA4 tRNA-Ala-GGC PGA2:3.127..3.127 Mbp (76 bp) score=10
trnR3 tRNA-Arg-ACG PGA2:3.149..3.15 Mbp (77 bp) score=10
trnR3 tRNA-Arg PGA2:3.149..3.15 Mbp (77 bp) score=10
ttcA tRNA 2-thiocytidine biosynthesis protein TtcA PGA2:3.155..3.156 Mbp (888 bp) score=10
trnW tRNA-Trp PGA2:3.228..3.228 Mbp (76 bp) score=10
trnW tRNA-Trp-CCA PGA2:3.228..3.228 Mbp (76 bp) score=10
fmt methionyl-tRNA formyltransferase Fmt PGA2:3.266..3.267 Mbp (906 bp) score=10
trmD tRNA (guanine-N(1)-)-methyltransferase TrmD PGA2:3.298..3.299 Mbp (801 bp) score=10
trnM6 tRNA-Met-CAT PGA2:3.328..3.328 Mbp (77 bp) score=10
trnM6 tRNA-Met PGA2:3.328..3.328 Mbp (77 bp) score=10
trnI4 tRNA-Ile PGA2:3.332..3.332 Mbp (77 bp) score=10
trnI4 tRNA-Ile-GAT PGA2:3.332..3.332 Mbp (77 bp) score=10
trnA5 tRNA-Ala PGA2:3.332..3.332 Mbp (76 bp) score=10
trnA5 tRNA-Ala-TGC PGA2:3.332..3.332 Mbp (76 bp) score=10
trnV3 tRNA-Val-GAC PGA2:3.346..3.346 Mbp (75 bp) score=10
trnV3 tRNA-Val PGA2:3.346..3.346 Mbp (75 bp) score=10
truB tRNA pseudouridine synthase B PGA2:3.392..3.393 Mbp (906 bp) score=10
leuS leucyl-tRNA synthetase PGA2:3.438..3.441 Mbp (2.574 kbp) score=10
trnR4 tRNA-Arg-CCT PGA2:3.487..3.488 Mbp (77 bp) score=10
trnR4 tRNA-Arg PGA2:3.487..3.488 Mbp (77 bp) score=10
trnK tRNA-Lys-TTT PGA2:3.495..3.495 Mbp (76 bp) score=10
trnK tRNA-Lys PGA2:3.495..3.495 Mbp (76 bp) score=10
PGA2_c32170 MiaB-like tRNA modifying enzyme PGA2:3.496..3.497 Mbp (1.266 kbp) score=10
PGA2_c33050 tRNA-nucleotidyltransferase PGA2:3.593..3.595 Mbp (1.155 kbp) score=10
mnmG tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG PGA2:3.618..3.62 Mbp (1.875 kbp) score=10
mnmE tRNA modification GTPase MnmE PGA2:3.62..3.622 Mbp (1.293 kbp) score=10
trnT3 tRNA-Thr PGA2:3.661..3.661 Mbp (76 bp) score=10
trnT3 tRNA-Thr-CGT PGA2:3.661..3.661 Mbp (76 bp) score=10
trnL5 tRNA-Leu-CAG PGA2:3.707..3.707 Mbp (87 bp) score=10
trnL5 tRNA-Leu PGA2:3.707..3.707 Mbp (87 bp) score=10
trnL6 tRNA-Leu-CAG PGA2:3.707..3.707 Mbp (87 bp) score=10
trnL6 tRNA-Leu PGA2:3.707..3.707 Mbp (87 bp) score=10
trnR tRNA-Arg-ACG PGA2:4.041..4.041 Mbp (77 bp) score=10
trnR tRNA-Arg PGA2:4.041..4.041 Mbp (77 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70