Roseobase: Phaeobacter gallaeciensis 2.10

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: PGA2:500000..600000, PGA2_c00030, PGA2_239p2120, argD, YP_006561290, tRNA-Leu, transposase, transcriptional regulator, PPHLDPTSAAAGAIDQVLYSNVFEGLTRFMGDGSVVPGLAQSWE.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 236 regions match your request.
Matches on PGA2
overview_PGA2
PGA2_c00050 TetR family transcriptional regulator PGA2:4.786..5.385 kbp (600 bp) score=20
PGA2_c00160 TetR family transcriptional regulator PGA2:16.65..17.27 kbp (627 bp) score=20
PGA2_c00410 IclR family HTH-type transcriptional regulator PGA2:44.85..45.66 kbp (810 bp) score=20
PGA2_c01110 HTH-type transcriptional regulator, TetR family PGA2:132.8..133.5 kbp (645 bp) score=20
PGA2_c01130 HTH-type transcriptional regulator, ArsR family PGA2:134.2..134.9 kbp (708 bp) score=20
PGA2_c01340 DeoR family HTH-type transcriptional regulator PGA2:156.1..157 kbp (837 bp) score=20
PGA2_c01670 LysR family transcriptional regulator PGA2:191.5..192.4 kbp (939 bp) score=20
PGA2_c01690 HTH-type transcriptional regulator, AraC family PGA2:193.5..194.6 kbp (1.035 kbp) score=20
PGA2_c01820 LysR family transcriptional regulator PGA2:205.2..206.1 kbp (882 bp) score=20
PGA2_c01990 MerR family transcriptional regulator PGA2:220.7..221.1 kbp (405 bp) score=20
PGA2_c02090 GntR family transcriptional regulator PGA2:238..238.6 kbp (666 bp) score=20
hmrR HTH-type transcriptional regulator PGA2:242.7..243.2 kbp (405 bp) score=20
PGA2_c02170 HTH-type transcriptional regulator pcaQ PGA2:246.2..247.1 kbp (918 bp) score=20
PGA2_c02290 HTH-type transcriptional regulator PGA2:262..263 kbp (1.014 kbp) score=20
PGA2_c02390 AraC family transcriptional regulator PGA2:273.9..274.8 kbp (873 bp) score=20
PGA2_c02410 AraC family transcriptional regulator PGA2:276.1..276.7 kbp (657 bp) score=20
PGA2_c03780 phosphonates metabolism transcriptional regulator phnF PGA2:413.6..414.3 kbp (735 bp) score=20
PGA2_c04030 TetR family transcriptional regulator PGA2:440..440.6 kbp (666 bp) score=20
PGA2_c04050 AsnC family transcriptional regulator PGA2:444.2..444.7 kbp (498 bp) score=20
PGA2_c04230 LysR family transcriptional regulator PGA2:463.2..464.1 kbp (909 bp) score=20
PGA2_c04660 GntR family transcriptional regulator PGA2:507.4..508.1 kbp (663 bp) score=20
PGA2_c05020 LysR family transcriptional regulator PGA2:562.7..563.7 kbp (975 bp) score=20
PGA2_c05100 IclR family transcriptional regulator PGA2:570.6..571.5 kbp (819 bp) score=20
PGA2_c06150 AsnC family transcriptional regulator PGA2:682.2..682.7 kbp (522 bp) score=20
PGA2_c06160 AsnC family transcriptional regulator PGA2:682.7..683.2 kbp (459 bp) score=20
PGA2_c06210 GntR family transcriptional regulator PGA2:686.4..687.1 kbp (654 bp) score=20
PGA2_c06540 LysR family transcriptional regulator PGA2:728.2..729.1 kbp (879 bp) score=20
PGA2_c06690 IclR family transcriptional regulator PGA2:743.4..744.4 kbp (1.074 kbp) score=20
PGA2_c06790 LacL family transcriptional regulator PGA2:754.6..755.6 kbp (1.029 kbp) score=20
PGA2_c06930 IclR family transcriptional regulator PGA2:771.1..771.9 kbp (792 bp) score=20
PGA2_c07110 AsnC/LRP family transcriptional regulator PGA2:790.2..790.6 kbp (456 bp) score=20
PGA2_c07580 LacL family transcriptional regulator PGA2:845.3..846.3 kbp (1.026 kbp) score=20
PGA2_c07630 LacL family transcriptional regulator PGA2:851.7..852.7 kbp (1.032 kbp) score=20
PGA2_c08080 LysR family transcriptional regulator PGA2:900.1..900.9 kbp (822 bp) score=20
PGA2_c08150 AraC family transcriptional regulator PGA2:907.3..908.4 kbp (1.092 kbp) score=20
PGA2_c08410 TetR family transcriptional regulator PGA2:933.2..933.8 kbp (618 bp) score=20
PGA2_c08910 HTH-type transcriptional regulator hmrR PGA2:983..983.3 kbp (384 bp) score=20
PGA2_c09230 AsnC family transcriptional regulator PGA2:1.013..1.013 Mbp (240 bp) score=20
PGA2_c09460 HTH-type transcriptional regulator, MarR family PGA2:1.042..1.042 Mbp (444 bp) score=20
PGA2_c09830 TetR family transcriptional regulator PGA2:1.089..1.09 Mbp (582 bp) score=20
PGA2_c09930 MerR family transcriptional regulator PGA2:1.099..1.099 Mbp (375 bp) score=20
PGA2_c11470 HTH-type transcriptional regulator PGA2:1.263..1.263 Mbp (438 bp) score=20
PGA2_c11540 LysR family transcriptional regulator PGA2:1.271..1.272 Mbp (906 bp) score=20
PGA2_c11790 two-component regulatory system, sensory/regulatory protein PGA2:1.302..1.304 Mbp (2.529 kbp) score=20
PGA2_c12080 transcriptional regulator , MerR family PGA2:1.337..1.338 Mbp (402 bp) score=20
PGA2_c12090 transcriptional regulator , MerR family PGA2:1.338..1.339 Mbp (378 bp) score=20
PGA2_c12490 AraC family transcriptional regulator PGA2:1.379..1.38 Mbp (1.008 kbp) score=20
PGA2_c12600 AraC family transcriptional regulator PGA2:1.388..1.388 Mbp (537 bp) score=20
PGA2_c12660 transcriptional regulator PGA2:1.394..1.395 Mbp (1.314 kbp) score=20
PGA2_c12800 TetR family transcriptional regulator PGA2:1.408..1.408 Mbp (627 bp) score=20
PGA2_c13030 GntR family transcriptional regulator PGA2:1.433..1.434 Mbp (711 bp) score=20
PGA2_c13170 LacL family transcriptional regulator PGA2:1.448..1.449 Mbp (1.032 kbp) score=20
PGA2_c13190 LysR family transcriptional regulator PGA2:1.449..1.45 Mbp (960 bp) score=20
dctD1 C4-dicarboxylate transport transcriptional regulatory protein DctD PGA2:1.468..1.469 Mbp (1.338 kbp) score=20
PGA2_c13740 AraC family transcriptional regulator PGA2:1.511..1.512 Mbp (1.068 kbp) score=20
PGA2_c13760 GntR family transcriptional regulator PGA2:1.513..1.514 Mbp (732 bp) score=20
PGA2_c13890 IacL family transcriptional regulator PGA2:1.528..1.529 Mbp (1.062 kbp) score=20
PGA2_c14090 AraC family transcriptional regulator PGA2:1.555..1.556 Mbp (1.077 kbp) score=20
PGA2_c14390 GntR family transcriptional regulator PGA2:1.585..1.587 Mbp (1.416 kbp) score=20
PGA2_c14850 transcriptional regulator PGA2:1.643..1.643 Mbp (624 bp) score=20
PGA2_c14890 transcriptional regulator PGA2:1.645..1.646 Mbp (834 bp) score=20
PGA2_c15240 transcriptional regulator PGA2:1.686..1.686 Mbp (459 bp) score=20
PGA2_c15530 IclR family transcriptional regulator PGA2:1.712..1.713 Mbp (795 bp) score=20
phoB phosphate regulon transcriptional regulatory protein PhoB PGA2:1.72..1.72 Mbp (690 bp) score=20
PGA2_c15730 AraC family transcriptional regulator PGA2:1.734..1.735 Mbp (1.005 kbp) score=20
PGA2_c16190 AsnC family transcriptional regulator PGA2:1.784..1.784 Mbp (426 bp) score=20
PGA2_c16440 AsnC family transcriptional regulator PGA2:1.814..1.814 Mbp (489 bp) score=20
PGA2_c16550 GntR family transcriptional regulator PGA2:1.828..1.829 Mbp (747 bp) score=20
PGA2_c16920 LysR family transcriptional regulator PGA2:1.874..1.874 Mbp (906 bp) score=20
PGA2_c17000 TetR family transcriptional regulator PGA2:1.88..1.881 Mbp (606 bp) score=20
PGA2_c17090 LysR family transcriptional regulator PGA2:1.889..1.89 Mbp (897 bp) score=20
PGA2_c18360 transcriptional regulator PGA2:2.034..2.035 Mbp (615 bp) score=20
PGA2_c18390 CRP family transcriptional regulator PGA2:2.038..2.039 Mbp (678 bp) score=20
PGA2_c18750 LysR family transcriptional regulator PGA2:2.076..2.077 Mbp (939 bp) score=20
PGA2_c19330 AsnC family transcriptional regulator PGA2:2.142..2.143 Mbp (480 bp) score=20
PGA2_c19370 transcriptional regulator PGA2:2.146..2.146 Mbp (423 bp) score=20
dctD2 C4-dicarboxylate transport transcriptional regulatory protein DctD PGA2:2.164..2.165 Mbp (1.23 kbp) score=20
PGA2_c19570 AsnC family transcriptional regulator PGA2:2.169..2.17 Mbp (480 bp) score=20
PGA2_c19970 GntR family transcriptional regulator PGA2:2.207..2.208 Mbp (780 bp) score=20
PGA2_c20070 MarR family transcriptional regulator PGA2:2.216..2.216 Mbp (498 bp) score=20
PGA2_c20160 LysR family HTH-type transcriptional regulator PGA2:2.223..2.224 Mbp (1.005 kbp) score=20
PGA2_c20170 HTH-type transcriptional regulator, deoR family PGA2:2.224..2.226 Mbp (1.41 kbp) score=20
PGA2_c20210 LysR family transcriptional regulator PGA2:2.228..2.229 Mbp (927 bp) score=20
PGA2_c20560 transcriptional regulator PGA2:2.271..2.272 Mbp (1.389 kbp) score=20
betI HTH-type transcriptional regulator PGA2:2.28..2.28 Mbp (576 bp) score=20
PGA2_c20660 ArgP family transcriptional regulator PGA2:2.283..2.284 Mbp (885 bp) score=20
PGA2_c20790 transcriptional regulator PGA2:2.299..2.299 Mbp (372 bp) score=20
PGA2_c20810 LysR family transcriptional regulator PGA2:2.301..2.302 Mbp (894 bp) score=20
PGA2_c21140 transcriptional regulator PGA2:2.333..2.334 Mbp (717 bp) score=20
PGA2_c21200 DeoR family transcriptional regulator PGA2:2.34..2.341 Mbp (837 bp) score=20
PGA2_c21260 AraC family transcriptional regulator PGA2:2.349..2.35 Mbp (1.05 kbp) score=20
PGA2_c21350 DeoR family transcriptional regulator PGA2:2.36..2.361 Mbp (792 bp) score=20
PGA2_c21420 MarR family transcriptional regulator PGA2:2.37..2.37 Mbp (459 bp) score=20
PGA2_c21590 transcriptional regulator PGA2:2.392..2.393 Mbp (633 bp) score=20
PGA2_c21640 CRP family transcriptional regulator PGA2:2.398..2.398 Mbp (765 bp) score=20
PGA2_c21840 CRP family transcriptional regulator PGA2:2.421..2.421 Mbp (735 bp) score=20
PGA2_c21850 LysR family HTH-type transcriptional regulator PGA2:2.422..2.423 Mbp (882 bp) score=20
PGA2_c22160 LysR family transcriptional regulator PGA2:2.452..2.453 Mbp (978 bp) score=20
PGA2_c22580 LysR type HTH-type transcriptional regulator PGA2:2.496..2.497 Mbp (882 bp) score=20
PGA2_c22630 MarR family transcriptional regulator PGA2:2.504..2.505 Mbp (498 bp) score=20
PGA2_c23020 LysR family transcriptional regulator PGA2:2.54..2.541 Mbp (876 bp) score=20
PGA2_c23250 AsnC family transcriptional regulator PGA2:2.564..2.564 Mbp (462 bp) score=20
PGA2_c23430 MarR family transcriptional regulator PGA2:2.579..2.58 Mbp (456 bp) score=20
PGA2_c23450 MarR family HTH-type transcriptional regulator PGA2:2.581..2.582 Mbp (498 bp) score=20
PGA2_c23600 transcriptional regulator PGA2:2.6..2.601 Mbp (921 bp) score=20
PGA2_c23660 TetR family transcriptional regulator PGA2:2.61..2.61 Mbp (612 bp) score=20
PGA2_c23730 HTH-type transcriptional regulator, AraC family PGA2:2.616..2.617 Mbp (1.053 kbp) score=20
PGA2_c23830 LysR family transcriptional regulator PGA2:2.628..2.629 Mbp (873 bp) score=20
PGA2_c23870 LysR family transcriptional regulator PGA2:2.634..2.635 Mbp (978 bp) score=20
PGA2_c24050 MarR family transcriptional regulator PGA2:2.655..2.655 Mbp (441 bp) score=20
PGA2_c24060 MarR family transcriptional regulator PGA2:2.655..2.656 Mbp (498 bp) score=20
PGA2_c24430 HTH-type transcriptional regulator PGA2:2.694..2.694 Mbp (465 bp) score=20
PGA2_c24580 LysR family transcriptional regulator PGA2:2.713..2.714 Mbp (858 bp) score=20
PGA2_c24830 TetR family transcriptional regulator PGA2:2.74..2.741 Mbp (597 bp) score=20
PGA2_c25150 HTH-type transcriptional regulator PGA2:2.77..2.771 Mbp (873 bp) score=20
PGA2_c25250 LysR family transcriptional regulator PGA2:2.782..2.782 Mbp (858 bp) score=20
PGA2_c25420 LacL family transcriptional regulator PGA2:2.799..2.8 Mbp (1.029 kbp) score=20
PGA2_c25620 transcriptional regulator PGA2:2.82..2.822 Mbp (1.362 kbp) score=20
PGA2_c26070 MarR family transcriptional regulator PGA2:2.872..2.873 Mbp (1.203 kbp) score=20
PGA2_c26300 GntR family transcriptional regulator PGA2:2.905..2.906 Mbp (681 bp) score=20
PGA2_c26440 transcriptional regulator PGA2:2.919..2.92 Mbp (618 bp) score=20
PGA2_c26490 TetR family transcriptional regulator PGA2:2.926..2.927 Mbp (603 bp) score=20
PGA2_c26540 LysR family HTH-type transcriptional regulator PGA2:2.929..2.93 Mbp (885 bp) score=20
PGA2_c26740 HTH-type transcriptional regulator, ArsR family PGA2:2.955..2.955 Mbp (318 bp) score=20
PGA2_c26750 GntR family transcriptional regulator PGA2:2.955..2.957 Mbp (1.476 kbp) score=20
PGA2_c26960 AraC family transcriptional regulator PGA2:2.978..2.979 Mbp (858 bp) score=20
pecS HTH-type transcriptional regulator PecS PGA2:2.981..2.981 Mbp (489 bp) score=20
PGA2_c27090 LysR family transcriptional regulator PGA2:2.988..2.989 Mbp (906 bp) score=20
PGA2_c28300 AsnC family transcriptional regulator PGA2:3.111..3.112 Mbp (459 bp) score=20
PGA2_c28320 TetR family transcriptional regulator PGA2:3.113..3.114 Mbp (600 bp) score=20
PGA2_c28420 AraC family transcriptional regulator PGA2:3.122..3.123 Mbp (837 bp) score=20
PGA2_c28450 GntR family HTH-type transcriptional regulator PGA2:3.125..3.126 Mbp (669 bp) score=20
PGA2_c28520 LysR family HTH-type transcriptional regulator PGA2:3.132..3.133 Mbp (879 bp) score=20
PGA2_c28560 RpiR family HTH-type transcriptional regulator PGA2:3.136..3.137 Mbp (855 bp) score=20
PGA2_c29070 GntR family transcriptional regulator PGA2:3.185..3.186 Mbp (1.413 kbp) score=20
PGA2_c29410 LysR family HTH-type transcriptional regulator PGA2:3.208..3.209 Mbp (897 bp) score=20
chvI transcriptional regulatory protein ChvI PGA2:3.245..3.246 Mbp (702 bp) score=20
PGA2_c30200 ArsR family transcriptional regulator PGA2:3.286..3.286 Mbp (348 bp) score=20
PGA2_c30220 LysR family transcriptional regulator PGA2:3.287..3.288 Mbp (879 bp) score=20
PGA2_c30410 MarR family transcriptional regulator PGA2:3.304..3.304 Mbp (441 bp) score=20
PGA2_c30590 LysR family HTH-type transcriptional regulator PGA2:3.327..3.328 Mbp (915 bp) score=20
PGA2_c31390 HTH-type transcriptional regulator, AraC family PGA2:3.411..3.412 Mbp (1.029 kbp) score=20
PGA2_c31600 transcriptional regulator PGA2:3.433..3.434 Mbp (687 bp) score=20
PGA2_c32080 HTH-type transcriptional regulator GntR PGA2:3.488..3.489 Mbp (1.026 kbp) score=20
ohrR organic hydroperoxide resistance transcriptional regulator PGA2:3.51..3.51 Mbp (447 bp) score=20
petP HTH-type transcriptional regulator PetP PGA2:3.512..3.513 Mbp (513 bp) score=20
PGA2_c32440 HTH-type transcriptional regulator, AraC family PGA2:3.524..3.525 Mbp (945 bp) score=20
PGA2_c32550 HTH-type transcriptional regulator PGA2:3.536..3.537 Mbp (567 bp) score=20
PGA2_c32620 GntR family HTH-type transcriptional regulator PGA2:3.545..3.546 Mbp (723 bp) score=20
PGA2_c32900 HTH-type transcriptional regulator, MarR family PGA2:3.577..3.578 Mbp (441 bp) score=20
PGA2_c34370 HTH-type transcriptional regulator, ArsR family PGA2:3.724..3.724 Mbp (321 bp) score=20
PGA2_c34480 GntR family HTH-type transcriptional regulator PGA2:3.733..3.734 Mbp (606 bp) score=20
PGA2_c34550 GntR family HTH-type transcriptional regulator PGA2:3.741..3.742 Mbp (741 bp) score=20
PGA2_95p090 putative HTH-type transcriptional regulator PGA2:3.839..3.839 Mbp (450 bp) score=20
PGA2_95p240 putative HTH-type transcriptional regulator PGA2:3.863..3.864 Mbp (1.041 kbp) score=20
PGA2_95p310 transcriptional regulatory protein, LysR family PGA2:3.87..3.871 Mbp (888 bp) score=20
PGA2_95p340 putative HTH-type transcriptional regulator PGA2:3.875..3.876 Mbp (612 bp) score=20
PGA2_95p410 putative HTH-type transcriptional regulator PGA2:3.885..3.886 Mbp (1.044 kbp) score=20
PGA2_95p420 putative transcriptional regulator PGA2:3.886..3.886 Mbp (633 bp) score=20
PGA2_95p580 putative HTH-type transcriptional regulator PGA2:3.906..3.907 Mbp (843 bp) score=20
PGA2_95p590 putative transcriptional regulator PGA2:3.907..3.908 Mbp (1.203 kbp) score=20
PGA2_95p640 putative transcriptional regulator, ArsR family PGA2:3.915..3.915 Mbp (363 bp) score=20
PGA2_239p0180 transcriptional regulator, AsnC family PGA2:3.945..3.946 Mbp (474 bp) score=20
PGA2_239p0200 transcriptional regulator, LysR family PGA2:3.947..3.948 Mbp (927 bp) score=20
PGA2_239p0270 transcriptional regulator, GntR family PGA2:3.954..3.955 Mbp (669 bp) score=20
PGA2_239p0290 putative transcriptional regulator PGA2:3.956..3.957 Mbp (612 bp) score=20
PGA2_239p0460 transcriptional regulator, MerR family PGA2:3.978..3.979 Mbp (429 bp) score=20
PGA2_239p0760 transcriptional regulator, AsnC family PGA2:4.009..4.009 Mbp (474 bp) score=20
tdaA transcriptional regulator, LysR family PGA2:4.031..4.032 Mbp (891 bp) score=20
PGA2_239p0980 transcriptional regulator, LysR family PGA2:4.032..4.033 Mbp (924 bp) score=20
PGA2_239p1180 transcriptional regulator, deoR type PGA2:4.055..4.056 Mbp (693 bp) score=20
PGA2_239p1300 HTH-type transcriptional regulator, lysR family PGA2:4.066..4.067 Mbp (912 bp) score=20
PGA2_239p1430 transcriptional regulator, crp family PGA2:4.081..4.082 Mbp (705 bp) score=20
PGA2_239p1460 transcriptional regulator, TetR family PGA2:4.084..4.084 Mbp (609 bp) score=20
PGA2_239p1470 transcriptional regulator, AraC family PGA2:4.085..4.086 Mbp (1.008 kbp) score=20
PGA2_239p1510 transcriptional regulator, MarR family PGA2:4.089..4.089 Mbp (558 bp) score=20
PGA2_239p1540 transcriptional regulator, LysR family PGA2:4.091..4.092 Mbp (906 bp) score=20
PGA2_239p1650 transcriptional regulator, LysR family PGA2:4.105..4.106 Mbp (897 bp) score=20
PGA2_239p1660 transcriptional regulator, AraC family PGA2:4.106..4.107 Mbp (1.008 kbp) score=20
PGA2_239p1710 transcriptional regulator, GntR family PGA2:4.113..4.114 Mbp (1.47 kbp) score=20
PGA2_239p1740 putative transcriptional regulator, AraC family PGA2:4.117..4.118 Mbp (1.026 kbp) score=20
PGA2_239p2070 putative transcriptional regulator, TetR family PGA2:4.156..4.157 Mbp (648 bp) score=20
lrp leucine-responsive regulatory protein Lrp PGA2:13.93..14.42 kbp (492 bp) score=10
PGA2_c01630 two component signal transduction response regulator receiver protein PGA2:186.1..186.8 kbp (693 bp) score=10
soxR1 redox-sensitive transcriptional activator PGA2:320..320.5 kbp (495 bp) score=10
PGA2_c02970 glycine cleavage system transcriptional activator PGA2:327.9..328.9 kbp (942 bp) score=10
PGA2_c03380 regulatory protein, H-NS histone family PGA2:370.7..371.1 kbp (318 bp) score=10
raiR transcriptional activator protein RaiR PGA2:377.6..378.4 kbp (720 bp) score=10
PGA2_c04220 metal ion uptake regulator PGA2:462.8..463.2 kbp (417 bp) score=10
PGA2_c06630 leucine-responsive regulatory protein PGA2:737.3..737.8 kbp (456 bp) score=10
PGA2_c07450 two component regulatory system PGA2:833.6..835.4 kbp (1.737 kbp) score=10
PGA2_c07710 two-component system response regulator PGA2:862..862.6 kbp (666 bp) score=10
pleD response regulator PleD PGA2:919.3..920.7 kbp (1.431 kbp) score=10
nrdR transcriptional repressor PGA2:953.4..953.9 kbp (468 bp) score=10
PGA2_c08970 mercuric resistance operon regulatory protein PGA2:988.2..988.6 kbp (408 bp) score=10
PGA2_c09200 transcription regulator, AraC family PGA2:1.011..1.012 Mbp (732 bp) score=10
PGA2_c11590 proline dehydrogenase transcriptional activator PGA2:1.278..1.279 Mbp (474 bp) score=10
soxR2 regulatory protein SoxR PGA2:1.368..1.368 Mbp (336 bp) score=10
PGA2_c12670 two-component system response regulator PGA2:1.395..1.396 Mbp (444 bp) score=10
PGA2_c12960 two-component system response regulator PGA2:1.426..1.426 Mbp (678 bp) score=10
ctrA cell cycle response regulator PGA2:1.571..1.572 Mbp (720 bp) score=10
ntrX nitrogen assimilation regulatory protein NtrX PGA2:1.623..1.624 Mbp (1.416 kbp) score=10
PGA2_c15130 two-component system histidine kinase / response regulator PGA2:1.673..1.675 Mbp (2.316 kbp) score=10
PGA2_c15480 transcriptional activator protein PGA2:1.707..1.708 Mbp (756 bp) score=10
PGA2_c15590 glycine cleavage system transcriptional activator PGA2:1.719..1.72 Mbp (957 bp) score=10
glnB1 nitrogen regulatory protein P-II PGA2:1.972..1.973 Mbp (339 bp) score=10
PGA2_c18970 similar to transcriptional activator protein TraR PGA2:2.106..2.106 Mbp (618 bp) score=10
PGA2_c19090 two-component signal transduction system, response regulator PGA2:2.118..2.118 Mbp (645 bp) score=10
gcrA cell cycle regulator GcrA PGA2:2.466..2.466 Mbp (657 bp) score=10
PGA2_c22510 signal transduction response regulator receiver PGA2:2.485..2.486 Mbp (720 bp) score=10
PGA2_c22770 leucine-responsive regulatory protein PGA2:2.516..2.517 Mbp (501 bp) score=10
PGA2_c23350 HTH-type transcriptional repressor nsrR PGA2:2.572..2.573 Mbp (456 bp) score=10
PGA2_c24880 phenylacetic acid degradation operon negative regulatory protein PGA2:2.746..2.746 Mbp (825 bp) score=10
PGA2_c25110 response regulator receiver protein PGA2:2.768..2.769 Mbp (816 bp) score=10
PGA2_c25270 response regulator PGA2:2.783..2.784 Mbp (693 bp) score=10
PGA2_c25310 response regulator PGA2:2.788..2.789 Mbp (432 bp) score=10
chrR transcriptional activator ChrR PGA2:2.81..2.81 Mbp (636 bp) score=10
PGA2_c26470 response regulator PGA2:2.923..2.923 Mbp (408 bp) score=10
PGA2_c26480 hybrid histidine kinase/response regulator PGA2:2.923..2.926 Mbp (3.135 kbp) score=10
glnB2 nitrogen regulatory protein P-II PGA2:3.009..3.009 Mbp (339 bp) score=10
fnrL transcriptional activator protein FnrL PGA2:3.085..3.086 Mbp (741 bp) score=10
PGA2_c28400 leucine-responsive regulatory protein PGA2:3.121..3.121 Mbp (453 bp) score=10
PGA2_c28510 related to araC family regulatory protein PGA2:3.131..3.132 Mbp (909 bp) score=10
PGA2_c30910 response regulator receiver protein PGA2:3.361..3.363 Mbp (1.902 kbp) score=10
PGA2_c30920 DNA-binding response regulator PGA2:3.363..3.364 Mbp (705 bp) score=10
PGA2_c33090 response regulator PGA2:3.597..3.598 Mbp (1.272 kbp) score=10
senC regulatory protein SenC PGA2:3.648..3.649 Mbp (621 bp) score=10
regA photosynthetic apparatus regulatory protein RegA PGA2:3.649..3.649 Mbp (555 bp) score=10
ptsN nitrogen regulatory protein PtsN PGA2:3.702..3.702 Mbp (465 bp) score=10
PGA2_71p060 putative regulatory protein, LuxR family PGA2:3.767..3.768 Mbp (1.185 kbp) score=10
PGA2_71p070 putative regulatory protein, LuxR family PGA2:3.769..3.77 Mbp (813 bp) score=10
PGA2_239p1760 putative metal ion uptake regulator PGA2:4.12..4.121 Mbp (387 bp) score=10
PGA2_239p1820 response regulator receiver -like protein PGA2:4.126..4.126 Mbp (387 bp) score=10
PGA2_239p1860 response regulator receiver PGA2:4.13..4.13 Mbp (375 bp) score=10
PGA2_239p1890 putative chemotaxis response regulator protein-glutamate methylesterase PGA2:4.133..4.134 Mbp (1.005 kbp) score=10
PGA2_239p1990 putative two-component sensor histidine kinase/response regulator hybrid protein PGA2:4.142..4.145 Mbp (2.28 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70