Roseobase: Roseobacter sp. GAI101

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RGAI101:500000..600000, pyrF, RGAI101_4201, ZP_05102392, tRNA-Leu, transcriptional regulator, QPGEKPRLPAPVVLLAQSEPGYENLMKLNSCLYIDKGGALPE.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 484 regions match your request.
Matches on RGAI101
overview_RGAI101
RGAI101_65 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:4.818..5.726 kbp (909 bp) score=40
RGAI101_108 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:28.05..28.41 kbp (363 bp) score=40
RGAI101_64 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:35.04..35.53 kbp (492 bp) score=40
RGAI101_58 transcriptional regulator, IclR family/MhpR [K] COG1414 Transcriptional regulator RGAI101:104.8..105.5 kbp (741 bp) score=40
RGAI101_102 transcriptional Regulator, XRE family with Cupin sensor domain [K] COG1396 Predicted transcriptional regulators RGAI101:133.6..134.2 kbp (570 bp) score=40
RGAI101_36 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:144.5..145.3 kbp (876 bp) score=40
RGAI101_1326 transcriptional regulator, CarD family [K] COG1329 Transcriptional regulators, similar to M. xanthus CarD RGAI101:145.6..146.1 kbp (516 bp) score=40
RGAI101_2194 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RGAI101:148.1..148.6 kbp (459 bp) score=40
RGAI101_269 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RGAI101:162.4..162.7 kbp (240 bp) score=40
RGAI101_2597 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RGAI101:261.9..262.3 kbp (378 bp) score=40
RGAI101_3670 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RGAI101:262.3..262.7 kbp (462 bp) score=40
RGAI101_3469 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RGAI101:265.8..266.6 kbp (762 bp) score=40
RGAI101_375 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:432.8..433.8 kbp (906 bp) score=40
RGAI101_1967 transcriptional regulator, IclR-family [K] COG1414 Transcriptional regulator RGAI101:472.3..473.1 kbp (810 bp) score=40
phnF phosphonates metabolism transcriptional regulator PhnF [K] COG1609 Transcriptional regulators RGAI101:487.5..488.2 kbp (714 bp) score=40
RGAI101_2844 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RGAI101:506.6..507.3 kbp (642 bp) score=40
RGAI101_255 TetR-family transcriptional regulator [K] COG1309 Transcriptional regulator RGAI101:514.5..515.2 kbp (654 bp) score=40
RGAI101_3427 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RGAI101:583..583.7 kbp (624 bp) score=40
RGAI101_2805 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:888.7..889.4 kbp (618 bp) score=40
RGAI101_499 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RGAI101:950.8..951.1 kbp (345 bp) score=40
RGAI101_1295 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RGAI101:978.1..978.9 kbp (786 bp) score=40
RGAI101_2969 putative transcriptional Regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:996.7..997.4 kbp (612 bp) score=40
RGAI101_3081 transcriptional regulator, BadM/Rrf2 family [K] COG1959 Predicted transcriptional regulator RGAI101:1.027..1.027 Mbp (462 bp) score=40
RGAI101_279 transcriptional regulator [K] COG1522 Transcriptional regulators RGAI101:1.031..1.032 Mbp (459 bp) score=40
RGAI101_1942 two component, sigma54 specific, transcriptional regulator, Fis family [KT] COG3829 Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains RGAI101:1.107..1.108 Mbp (1.23 kbp) score=40
RGAI101_2103 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:1.138..1.139 Mbp (897 bp) score=40
RGAI101_2918 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RGAI101:1.2..1.202 Mbp (1.296 kbp) score=40
RGAI101_1030 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:1.233..1.233 Mbp (471 bp) score=40
oxyR transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:1.301..1.302 Mbp (942 bp) score=40
RGAI101_2111 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:1.302..1.303 Mbp (897 bp) score=40
RGAI101_1068 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RGAI101:1.35..1.351 Mbp (765 bp) score=40
RGAI101_459 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:1.501..1.502 Mbp (666 bp) score=40
RGAI101_490 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:1.515..1.516 Mbp (945 bp) score=40
RGAI101_1713 beta-ketoadipate pathway transcriptional regulator, PcaR/PcaU/PobR family [K] COG1414 Transcriptional regulator RGAI101:1.53..1.531 Mbp (744 bp) score=40
RGAI101_1156 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:1.532..1.533 Mbp (597 bp) score=40
RGAI101_2990 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:1.543..1.544 Mbp (687 bp) score=40
RGAI101_1505 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:1.558..1.558 Mbp (588 bp) score=40
RGAI101_1453 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RGAI101:1.613..1.614 Mbp (399 bp) score=40
RGAI101_3645 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RGAI101:1.651..1.653 Mbp (1.452 kbp) score=40
RGAI101_288 transcriptional regulator, Cro/CI family, putative [K] COG1396 Predicted transcriptional regulators RGAI101:1.675..1.675 Mbp (312 bp) score=40
RGAI101_815 transcriptional regulatory protein [K] COG0583 Transcriptional regulator RGAI101:1.763..1.763 Mbp (597 bp) score=40
RGAI101_2000 transcriptional regulatory protein [K] COG0583 Transcriptional regulator RGAI101:1.763..1.764 Mbp (312 bp) score=40
RGAI101_2036 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RGAI101:1.787..1.787 Mbp (708 bp) score=40
RGAI101_769 transcriptional regulator [K] COG1733 Predicted transcriptional regulators RGAI101:1.814..1.814 Mbp (426 bp) score=40
RGAI101_2648 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:1.848..1.849 Mbp (864 bp) score=40
RGAI101_2304 transcriptional regulator SoxR [K] COG0640 Predicted transcriptional regulators RGAI101:1.966..1.966 Mbp (309 bp) score=40
frcR transcriptional regulator, ROK family [KG] COG1940 Transcriptional regulator/sugar kinase RGAI101:1.967..1.968 Mbp (1.197 kbp) score=40
RGAI101_1741 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RGAI101:1.988..1.989 Mbp (777 bp) score=40
RGAI101_1791 putative transcriptional Regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:2.092..2.093 Mbp (609 bp) score=40
RGAI101_1108 transcriptional regulator, GntR family protein [K] COG2188 Transcriptional regulators RGAI101:2.098..2.099 Mbp (798 bp) score=40
RGAI101_3438 transcriptional regulator, RpiR family [K] COG1737 Transcriptional regulators RGAI101:2.107..2.108 Mbp (954 bp) score=40
RGAI101_3439 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:2.135..2.136 Mbp (966 bp) score=40
RGAI101_2309 transcriptional regulator, MocR family [K] COG1725 Predicted transcriptional regulators RGAI101:2.253..2.254 Mbp (1.362 kbp) score=40
RGAI101_371 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:2.367..2.368 Mbp (666 bp) score=40
RGAI101_1878 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:2.37..2.371 Mbp (684 bp) score=40
RGAI101_1910 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:2.543..2.543 Mbp (618 bp) score=40
RGAI101_3516 negative transcriptional regulator [K] COG2808 Transcriptional regulator RGAI101:2.631..2.632 Mbp (624 bp) score=40
marR transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:2.637..2.637 Mbp (624 bp) score=40
RGAI101_2614 transcriptional Regulator, XRE family with Cupin sensor domain [K] COG1396 Predicted transcriptional regulators RGAI101:2.728..2.729 Mbp (552 bp) score=40
RGAI101_1356 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:2.777..2.778 Mbp (480 bp) score=40
RGAI101_3581 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:2.85..2.851 Mbp (438 bp) score=40
RGAI101_281 transcriptional regulatory protein [K] COG0583 Transcriptional regulator RGAI101:2.9..2.901 Mbp (900 bp) score=40
RGAI101_2426 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RGAI101:2.901..2.902 Mbp (444 bp) score=40
RGAI101_2391 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RGAI101:2.902..2.902 Mbp (273 bp) score=40
RGAI101_2420 transcriptional regulatory protein [K] COG1802 Transcriptional regulators RGAI101:2.913..2.914 Mbp (711 bp) score=40
RGAI101_1347 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:2.918..2.919 Mbp (906 bp) score=40
RGAI101_180 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RGAI101:2.964..2.965 Mbp (681 bp) score=40
RGAI101_3678 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RGAI101:3.008..3.009 Mbp (672 bp) score=40
RGAI101_2076 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RGAI101:3.011..3.011 Mbp (636 bp) score=40
RGAI101_1958 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.022..3.023 Mbp (945 bp) score=40
RGAI101_2232 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.081..3.082 Mbp (906 bp) score=40
RGAI101_2270 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:3.115..3.115 Mbp (513 bp) score=40
RGAI101_1305 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:3.136..3.137 Mbp (594 bp) score=40
RGAI101_1789 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RGAI101:3.154..3.154 Mbp (651 bp) score=40
RGAI101_1766 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RGAI101:3.176..3.177 Mbp (462 bp) score=40
RGAI101_296 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:3.255..3.256 Mbp (657 bp) score=40
RGAI101_329 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RGAI101:3.281..3.282 Mbp (492 bp) score=40
RGAI101_1916 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.286..3.287 Mbp (897 bp) score=40
RGAI101_3207 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:3.308..3.308 Mbp (789 bp) score=40
RGAI101_193 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:3.357..3.357 Mbp (450 bp) score=40
RGAI101_903 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.368..3.369 Mbp (876 bp) score=40
RGAI101_1051 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RGAI101:3.37..3.37 Mbp (366 bp) score=40
RGAI101_2004 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RGAI101:3.4..3.4 Mbp (366 bp) score=40
RGAI101_1837 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:3.584..3.585 Mbp (573 bp) score=40
RGAI101_1138 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RGAI101:3.6..3.6 Mbp (501 bp) score=40
RGAI101_1322 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RGAI101:3.644..3.644 Mbp (402 bp) score=40
RGAI101_1583 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RGAI101:3.645..3.646 Mbp (378 bp) score=40
RGAI101_2521 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.654..3.654 Mbp (894 bp) score=40
RGAI101_3140 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RGAI101:3.694..3.695 Mbp (345 bp) score=40
RGAI101_2806 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:3.761..3.762 Mbp (480 bp) score=40
RGAI101_541 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.821..3.822 Mbp (936 bp) score=40
metR HTH-type transcriptional regulator MetR [K] COG0583 Transcriptional regulator RGAI101:3.839..3.84 Mbp (906 bp) score=40
RGAI101_151 transcriptional regulatory protein [K] COG0583 Transcriptional regulator RGAI101:3.854..3.855 Mbp (885 bp) score=40
RGAI101_2759 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.858..3.859 Mbp (888 bp) score=40
RGAI101_2368 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RGAI101:3.879..3.88 Mbp (891 bp) score=40
nrdR transcriptional regulator NrdR [K] COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains RGAI101:3.913..3.913 Mbp (468 bp) score=40
RGAI101_3974 transcriptional regulator, GntR family [K] COG2188 Transcriptional regulators RGAI101:3.976..3.977 Mbp (816 bp) score=40
RGAI101_3985 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:3.99..3.99 Mbp (564 bp) score=40
RGAI101_3779 transcriptional regulatory protein [K] COG2188 Transcriptional regulators RGAI101:3.994..3.994 Mbp (732 bp) score=40
RGAI101_3969 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RGAI101:4.001..4.001 Mbp (156 bp) score=40
RGAI101_3951 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:4.009..4.009 Mbp (501 bp) score=40
RGAI101_3759 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RGAI101:4.099..4.1 Mbp (708 bp) score=40
RGAI101_3861 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RGAI101:4.113..4.114 Mbp (600 bp) score=40
RGAI101_4213 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:4.218..4.218 Mbp (474 bp) score=40
RGAI101_4218 transcriptional regulatory protein [K] COG1846 Transcriptional regulators RGAI101:4.248..4.249 Mbp (483 bp) score=40
RGAI101_4066 transcriptional regulator [K] COG1846 Transcriptional regulators RGAI101:4.263..4.263 Mbp (441 bp) score=40
RGAI101_4170 transcriptional regulator, GntR family, putative [K] COG1725 Predicted transcriptional regulators RGAI101:4.278..4.279 Mbp (936 bp) score=40
RGAI101_4064 transcriptional regulator [K] COG1309 Transcriptional regulator RGAI101:4.295..4.295 Mbp (678 bp) score=40
RGAI101_4085 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RGAI101:4.319..4.32 Mbp (405 bp) score=40
RGAI101_4051 transcriptional regulator, RpiR family [K] COG1737 Transcriptional regulators RGAI101:4.331..4.332 Mbp (867 bp) score=40
RGAI101_4171 transcriptional regulatory protein [K] COG2186 Transcriptional regulators RGAI101:4.365..4.365 Mbp (648 bp) score=40
RGAI101_4227 putative transcriptional regulator superfamily [K] COG1733 Predicted transcriptional regulators RGAI101:4.383..4.384 Mbp (399 bp) score=40
RGAI101_4257 transcriptional regulatory protein [K] COG1733 Predicted transcriptional regulators RGAI101:4.387..4.387 Mbp (444 bp) score=40
RGAI101_4065 transcriptional regulator, HxlR family [K] COG1733 Predicted transcriptional regulators RGAI101:4.465..4.466 Mbp (660 bp) score=40
RGAI101_4050 transcriptional regulator, DeoR family [KG] COG1349 Transcriptional regulators of sugar metabolism RGAI101:4.499..4.499 Mbp (843 bp) score=40
RGAI101_1348 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:194.1..194.8 kbp (657 bp) score=30
hpaR homoprotocatechuate degradation operon regulator, HpaR [K] COG1846 Transcriptional regulators RGAI101:524.1..524.6 kbp (486 bp) score=30
RGAI101_362 transcriptional regulator, MerR family [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:562.3..563.4 kbp (1.122 kbp) score=30
dctD C4-dicarboxylate transport transcriptional regulatory protein DctD [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RGAI101:670.2..671.5 kbp (1.335 kbp) score=30
RGAI101_2892 regulatory protein GntR, HTH [K] COG1802 Transcriptional regulators RGAI101:684.6..685.4 kbp (756 bp) score=30
phoB phosphate regulon transcriptional regulatory protein PhoB [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:773..773.7 kbp (690 bp) score=30
ctrA transcriptional regulator CtrA [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:902.9..903.6 kbp (720 bp) score=30
grp glutamate uptake regulatory protein [K] COG1522 Transcriptional regulators RGAI101:1.111..1.111 Mbp (462 bp) score=30
RGAI101_2463 regulatory protein GntR, HTH, putative [K] COG2188 Transcriptional regulators RGAI101:1.457..1.457 Mbp (741 bp) score=30
betI transcriptional repressor BetI [K] COG1309 Transcriptional regulator RGAI101:1.659..1.659 Mbp (561 bp) score=30
pcaQ pca operon transcriptional activator PcaQ [K] COG0583 Transcriptional regulator RGAI101:1.725..1.726 Mbp (906 bp) score=30
RGAI101_425 two component transcriptional regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RGAI101:1.809..1.809 Mbp (615 bp) score=30
RGAI101_554 putative regulatory protein, possibly two-component response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:1.918..1.92 Mbp (1.566 kbp) score=30
RGAI101_1396 transcriptional regulator, MarR family [K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family) RGAI101:2.329..2.33 Mbp (525 bp) score=30
RGAI101_2562 transcriptional regulator, Crp/Fnr family [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RGAI101:2.627..2.627 Mbp (660 bp) score=30
RGAI101_3187 regulatory protein GntR, HTH:GntR, C-terminal domain [K] COG1802 Transcriptional regulators RGAI101:3.182..3.183 Mbp (693 bp) score=30
RGAI101_737 regulator of the anaerobic catobolism of benzoate BzdR [K] COG1396 Predicted transcriptional regulators RGAI101:3.347..3.348 Mbp (891 bp) score=30
RGAI101_2671 transcriptional regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RGAI101:3.787..3.788 Mbp (744 bp) score=30
putR proline dehydrogenase transcriptional activator [K] COG1522 Transcriptional regulators RGAI101:3.845..3.845 Mbp (486 bp) score=30
RGAI101_2406 two component transcriptional regulator, winged helix family, putative [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:3.88..3.881 Mbp (768 bp) score=30
RGAI101_3940 regulatory protein, LysR:LysR, substrate-binding [K] COG0583 Transcriptional regulator RGAI101:4.202..4.203 Mbp (903 bp) score=30
RGAI101_4077 transcription regulator [K] COG2188 Transcriptional regulators RGAI101:4.456..4.457 Mbp (738 bp) score=30
gcvA regulator of gcv operon (LysR family) [K] COG0583 Transcriptional regulator RGAI101:4.477..4.478 Mbp (924 bp) score=30
RGAI101_53 [K] COG1959 Predicted transcriptional regulator RGAI101:29.84..30.29 kbp (450 bp) score=20
RGAI101_93 [K] COG0583 Transcriptional regulator RGAI101:39.98..40.9 kbp (921 bp) score=20
repB [K] COG1475 Predicted transcriptional regulators RGAI101:92.89..93.88 kbp (996 bp) score=20
RGAI101_92 [K] COG1396 Predicted transcriptional regulators RGAI101:103.2..104.2 kbp (1.002 kbp) score=20
RGAI101_48 [K] COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RGAI101:132..132.6 kbp (576 bp) score=20
RGAI101_593 [KG] COG1940 Transcriptional regulator/sugar kinase RGAI101:179.8..180.8 kbp (1.044 kbp) score=20
RGAI101_755 [K] COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RGAI101:394.1..394.9 kbp (774 bp) score=20
RGAI101_1841 [K] COG2378 Predicted transcriptional regulator; helix-turn-helix, type 11 RGAI101:407..407.6 kbp (639 bp) score=20
scpB [K] COG1386 Predicted transcriptional regulator containing the HTH domain RGAI101:560..560.6 kbp (606 bp) score=20
RGAI101_1212 two component response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:724.3..725 kbp (678 bp) score=20
RGAI101_1932 transcriptional regulator, AraC family RGAI101:760.7..761.6 kbp (972 bp) score=20
phoU phosphate transport system regulatory protein PhoU [P] COG0704 Phosphate uptake regulator RGAI101:772.3..773 kbp (708 bp) score=20
RGAI101_3603 transcriptional regulator, AraC family RGAI101:801.4..802.4 kbp (1.026 kbp) score=20
RGAI101_162 transcriptional regulator, GntR family RGAI101:891.7..893.1 kbp (1.422 kbp) score=20
pobR transcriptional regulator, AraC family RGAI101:918.1..919 kbp (804 bp) score=20
narL two component response regulator [T] COG4566 Response regulator RGAI101:974.1..974.8 kbp (657 bp) score=20
RGAI101_2246 transcriptional regulator, AraC family RGAI101:1.049..1.049 Mbp (891 bp) score=20
RGAI101_2642 transcriptional regulator, AraC family RGAI101:1.066..1.066 Mbp (795 bp) score=20
fnrL transcriptional activator protein FnrL [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RGAI101:1.08..1.081 Mbp (735 bp) score=20
RGAI101_1184 [K] COG5007 Predicted transcriptional regulator, BolA superfamily RGAI101:1.127..1.128 Mbp (309 bp) score=20
RGAI101_487 response regulator receiver domain protein [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain RGAI101:1.263..1.263 Mbp (669 bp) score=20
RGAI101_3356 DNA-binding response regulator, LuxR family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:1.329..1.33 Mbp (702 bp) score=20
glpR [KG] COG1349 Transcriptional regulators of sugar metabolism RGAI101:1.363..1.363 Mbp (759 bp) score=20
RGAI101_2367 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:1.438..1.439 Mbp (672 bp) score=20
pleD diguanylate cyclase response regulator [T] COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain RGAI101:1.567..1.569 Mbp (1.404 kbp) score=20
mucS transcriptional regulator, MarR family RGAI101:1.612..1.613 Mbp (138 bp) score=20
RGAI101_1971 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD [V] COG3023 Negative regulator of beta-lactamase expression RGAI101:1.679..1.68 Mbp (675 bp) score=20
RGAI101_3497 response regulator receiver domain protein [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:1.793..1.794 Mbp (975 bp) score=20
RGAI101_908 response regulator receiver domain protein [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:1.794..1.795 Mbp (945 bp) score=20
RGAI101_3522 transcriptional regulator, LacI family RGAI101:1.834..1.834 Mbp (579 bp) score=20
RGAI101_125 transcriptional regulator, TetR family RGAI101:1.84..1.841 Mbp (591 bp) score=20
RGAI101_3042 two-component system response regulator [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RGAI101:1.937..1.937 Mbp (450 bp) score=20
RGAI101_2518 periplasmic binding protein/LacI transcriptional regulator RGAI101:1.968..1.97 Mbp (1.02 kbp) score=20
RGAI101_121 HTH-type transcriptional regulator NsrR RGAI101:2.067..2.068 Mbp (459 bp) score=20
RGAI101_2192 transcriptional regulator, LuxR family protein RGAI101:2.076..2.076 Mbp (540 bp) score=20
RGAI101_748 GcrA cell cycle regulator [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.153..2.154 Mbp (576 bp) score=20
luxR autoinducer-binding transcriptional regulator LuxR RGAI101:2.285..2.285 Mbp (720 bp) score=20
RGAI101_117 putative transcriptional regulator, CopG family RGAI101:2.362..2.363 Mbp (417 bp) score=20
RGAI101_1678 response regulator receiver domain protein [T] COG3707 Response regulator with putative antiterminator output domain RGAI101:2.365..2.366 Mbp (372 bp) score=20
RGAI101_2191 transcriptional regulator, Fis family RGAI101:2.405..2.406 Mbp (1.368 kbp) score=20
RGAI101_928 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:2.413..2.414 Mbp (702 bp) score=20
RGAI101_3124 [K] COG1396 Predicted transcriptional regulators RGAI101:2.487..2.488 Mbp (573 bp) score=20
mtrA two component response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:2.505..2.506 Mbp (660 bp) score=20
RGAI101_209 putative response regulator recevier domain protein [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:2.529..2.529 Mbp (390 bp) score=20
RGAI101_236 transcriptional regulator, LacI family RGAI101:2.607..2.608 Mbp (972 bp) score=20
petR DNA-binding response regulator PetR [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:2.636..2.637 Mbp (693 bp) score=20
RGAI101_2570 [KE] COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RGAI101:2.762..2.763 Mbp (1.125 kbp) score=20
xylR [KG] COG1940 Transcriptional regulator/sugar kinase RGAI101:2.766..2.767 Mbp (1.161 kbp) score=20
parB [K] COG1475 Predicted transcriptional regulators RGAI101:2.815..2.816 Mbp (837 bp) score=20
hrcA [K] COG1420 Transcriptional regulator of heat shock gene RGAI101:2.818..2.819 Mbp (1.065 kbp) score=20
RGAI101_445 response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:2.834..2.835 Mbp (1.227 kbp) score=20
RGAI101_3408 [K] COG1396 Predicted transcriptional regulators RGAI101:2.932..2.932 Mbp (567 bp) score=20
tauR transcriptional regulator RGAI101:3.109..3.11 Mbp (1.464 kbp) score=20
RGAI101_337 transcriptional regulatory protein RGAI101:3.133..3.134 Mbp (885 bp) score=20
pdhR [K] COG1802 Transcriptional regulators RGAI101:3.373..3.374 Mbp (771 bp) score=20
RGAI101_3502 transcriptional regulator, LysR family domain protein, putative RGAI101:3.4..3.401 Mbp (828 bp) score=20
chvI DNA-binding response regulator ChvI [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:3.404..3.405 Mbp (702 bp) score=20
RGAI101_1956 transcriptional regulator, MarR family with acetyltransferase activity RGAI101:3.424..3.424 Mbp (492 bp) score=20
RGAI101_1160 two-component response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:3.492..3.493 Mbp (672 bp) score=20
RGAI101_2876 transcriptional regulator, Fur family RGAI101:3.671..3.671 Mbp (420 bp) score=20
RGAI101_3600 transcriptional regulator, Fis family RGAI101:3.717..3.718 Mbp (1.176 kbp) score=20
RGAI101_2890 [K] COG1802 Transcriptional regulators RGAI101:3.862..3.863 Mbp (753 bp) score=20
RGAI101_1572 transcriptional regulator, TraR/DksA family RGAI101:3.929..3.929 Mbp (270 bp) score=20
RGAI101_3751 transcriptional regulator RGAI101:3.945..3.945 Mbp (306 bp) score=20
RGAI101_3971 [K] COG1475 Predicted transcriptional regulators; rb102 RGAI101:3.968..3.969 Mbp (1.053 kbp) score=20
RGAI101_3781 transcriptional regulator, LuxR family protein RGAI101:4.121..4.122 Mbp (516 bp) score=20
RGAI101_4044 transcriptional Regulator, XRE family with Cupin sensor domain RGAI101:4.285..4.285 Mbp (615 bp) score=20
cheY chemotaxis response regulator, CheY1 [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:4.313..4.313 Mbp (369 bp) score=20
tctD two component response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RGAI101:4.373..4.373 Mbp (675 bp) score=20
RGAI101_23 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:11.76..12.48 kbp (723 bp) score=10
RGAI101_63 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:13.31..14.09 kbp (783 bp) score=10
RGAI101_13 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:42.42..44.15 kbp (1.728 kbp) score=10
RGAI101_17 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:50.03..52.12 kbp (2.082 kbp) score=10
RGAI101_26 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:54.87..64.72 kbp (9.855 kbp) score=10
RGAI101_84 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:91.41..92.65 kbp (1.245 kbp) score=10
RGAI101_39 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:112.2..113.1 kbp (870 bp) score=10
RGAI101_60 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:125.4..126.7 kbp (1.275 kbp) score=10
RGAI101_25 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:141..141.5 kbp (465 bp) score=10
RGAI101_3647 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:150..152.7 kbp (2.76 kbp) score=10
RGAI101_2923 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:207.8..211.9 kbp (4.155 kbp) score=10
RGAI101_3376 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:232.3..233.3 kbp (1.011 kbp) score=10
RGAI101_1969 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:278.5..279 kbp (540 bp) score=10
RGAI101_2612 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; hemolysin-type calcium-binding region RGAI101:311.3..313.1 kbp (1.746 kbp) score=10
RGAI101_1194 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:357.5..358.1 kbp (564 bp) score=10
RGAI101_1174 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:401.2..401.6 kbp (360 bp) score=10
RGAI101_3405 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:401.6..402.6 kbp (1.014 kbp) score=10
RGAI101_968 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:406.2..406.6 kbp (351 bp) score=10
RGAI101_2578 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:406.6..407 kbp (363 bp) score=10
RGAI101_916 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:408.1..408.7 kbp (621 bp) score=10
RGAI101_3390 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:427..428.1 kbp (1.038 kbp) score=10
lexA [KT] COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) RGAI101:451..451.7 kbp (720 bp) score=10
yibQ [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:456.9..458.3 kbp (1.41 kbp) score=10
RGAI101_1459 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:507.6..508.3 kbp (660 bp) score=10
RGAI101_2718 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:508.4..509.4 kbp (1.062 kbp) score=10
RGAI101_1086 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:509.4..512.5 kbp (3.099 kbp) score=10
RGAI101_1821 transcriptional accessory protein RGAI101:521.5..523.9 kbp (2.409 kbp) score=10
RGAI101_208 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:557.3..558.2 kbp (864 bp) score=10
RGAI101_2095 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:566.3..566.8 kbp (522 bp) score=10
RGAI101_1376 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:572.8..573.5 kbp (657 bp) score=10
RGAI101_2828 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:591.8..593.1 kbp (1.326 kbp) score=10
RGAI101_2497 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:601.1..602.2 kbp (1.062 kbp) score=10
RGAI101_3188 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:638.4..639.1 kbp (708 bp) score=10
RGAI101_3708 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:649.4..650 kbp (588 bp) score=10
RGAI101_2266 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:650..650.4 kbp (393 bp) score=10
RGAI101_2444 nitrogen regulatory protein P-II RGAI101:653.1..653.5 kbp (339 bp) score=10
RGAI101_1368 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:660.7..661.4 kbp (639 bp) score=10
RGAI101_2291 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:676.5..677.7 kbp (1.23 kbp) score=10
RGAI101_1512 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:680.5..680.7 kbp (177 bp) score=10
RGAI101_3410 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:700.7..702.1 kbp (1.335 kbp) score=10
RGAI101_1653 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; overlaps another CDS with the same product name RGAI101:707..708.5 kbp (1.539 kbp) score=10
RGAI101_3541 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:715.7..716.1 kbp (372 bp) score=10
RGAI101_1306 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:730..730.3 kbp (300 bp) score=10
RGAI101_1739 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:733..733.5 kbp (525 bp) score=10
RGAI101_417 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:735.2..736 kbp (747 bp) score=10
RGAI101_3337 [T] COG3629 DNA-binding transcriptional activator of the SARP family RGAI101:742.3..742.5 kbp (153 bp) score=10
RGAI101_1502 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:743..746 kbp (2.958 kbp) score=10
RGAI101_2618 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; hemolysin-type calcium-binding region RGAI101:791.8..793.1 kbp (1.269 kbp) score=10
RGAI101_2139 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:819.9..820.4 kbp (411 bp) score=10
RGAI101_1404 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:845.2..846.1 kbp (822 bp) score=10
glnG [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RGAI101:861.9..863.3 kbp (1.413 kbp) score=10
ntrC [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RGAI101:865.7..867 kbp (1.368 kbp) score=10
RGAI101_1642 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:878.2..879.2 kbp (1.017 kbp) score=10
RGAI101_1278 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:903.7..904 kbp (246 bp) score=10
RGAI101_992 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RGAI101:924..924.7 kbp (660 bp) score=10
RGAI101_366 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:924.8..925.3 kbp (498 bp) score=10
RGAI101_719 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:939.3..941.2 kbp (1.857 kbp) score=10
RGAI101_911 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:941.3..944.8 kbp (3.534 kbp) score=10
RGAI101_3500 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:956.4..957.8 kbp (1.398 kbp) score=10
RGAI101_2609 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:965.9..966.3 kbp (408 bp) score=10
ilvN [E] COG0440 Acetolactate synthase, small (regulatory) subunit RGAI101:976.9..977.5 kbp (603 bp) score=10
RGAI101_1210 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.015..1.015 Mbp (297 bp) score=10
RGAI101_373 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.023..1.023 Mbp (807 bp) score=10
RGAI101_677 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.031..1.031 Mbp (207 bp) score=10
cckA sensor histidine kinase/response regulator RGAI101:1.039..1.042 Mbp (2.229 kbp) score=10
RGAI101_2874 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.044..1.046 Mbp (1.344 kbp) score=10
RGAI101_196 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.073..1.073 Mbp (282 bp) score=10
RGAI101_2329 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.077..1.077 Mbp (696 bp) score=10
RGAI101_3415 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.147..1.147 Mbp (540 bp) score=10
RGAI101_1981 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.152..1.155 Mbp (3.303 kbp) score=10
RGAI101_1708 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.167..1.171 Mbp (3.927 kbp) score=10
RGAI101_1715 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.175..1.175 Mbp (411 bp) score=10
RGAI101_3219 response regulator receiver domain protein RGAI101:1.2..1.2 Mbp (384 bp) score=10
RGAI101_239 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.271..1.271 Mbp (684 bp) score=10
RGAI101_960 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.286..1.286 Mbp (330 bp) score=10
RGAI101_858 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.324..1.325 Mbp (327 bp) score=10
RGAI101_697 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.334..1.335 Mbp (441 bp) score=10
RGAI101_2248 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.336..1.337 Mbp (1.113 kbp) score=10
RGAI101_3679 regulatory protein NosR RGAI101:1.344..1.346 Mbp (2.103 kbp) score=10
RGAI101_1727 response regulator receiver domain protein RGAI101:1.352..1.352 Mbp (375 bp) score=10
RGAI101_2498 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.385..1.386 Mbp (831 bp) score=10
RGAI101_3561 sensory transduction regulatory protein RGAI101:1.415..1.417 Mbp (1.965 kbp) score=10
RGAI101_2853 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.421..1.421 Mbp (438 bp) score=10
RGAI101_2132 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.43..1.43 Mbp (318 bp) score=10
RGAI101_3288 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.436..1.437 Mbp (432 bp) score=10
RGAI101_2634 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.446..1.446 Mbp (759 bp) score=10
RGAI101_2233 [T] COG3707 Response regulator with putative antiterminator output domain RGAI101:1.474..1.475 Mbp (600 bp) score=10
amiC_2 negative aliphatic amidase regulator RGAI101:1.475..1.476 Mbp (1.053 kbp) score=10
RGAI101_1907 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RGAI101:1.498..1.501 Mbp (2.346 kbp) score=10
RGAI101_1066 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.505..1.506 Mbp (426 bp) score=10
hflK [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.547..1.548 Mbp (1.221 kbp) score=10
RGAI101_2059 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.564..1.564 Mbp (588 bp) score=10
RGAI101_2798 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; overlaps another CDS with the same product name RGAI101:1.571..1.572 Mbp (1.422 kbp) score=10
RGAI101_3112 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.601..1.602 Mbp (750 bp) score=10
RGAI101_206 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; overlaps another CDS with the same product name RGAI101:1.61..1.611 Mbp (711 bp) score=10
RGAI101_2685 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; overlaps another CDS with the same product name RGAI101:1.611..1.611 Mbp (714 bp) score=10
RGAI101_3508 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.619..1.62 Mbp (762 bp) score=10
RGAI101_2298 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.64..1.641 Mbp (627 bp) score=10
RGAI101_2961 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.647..1.647 Mbp (207 bp) score=10
RGAI101_3271 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.647..1.648 Mbp (348 bp) score=10
RGAI101_2295 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.668..1.669 Mbp (1.188 kbp) score=10
RGAI101_454 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.688..1.689 Mbp (927 bp) score=10
RGAI101_287 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.691..1.693 Mbp (1.161 kbp) score=10
RGAI101_2991 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.699..1.702 Mbp (3.513 kbp) score=10
RGAI101_1197 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.721..1.721 Mbp (573 bp) score=10
expE [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; putative protein RGAI101:1.736..1.737 Mbp (870 bp) score=10
RGAI101_3283 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.738..1.739 Mbp (1.26 kbp) score=10
RGAI101_592 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.742..1.743 Mbp (807 bp) score=10
RGAI101_2723 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.761..1.762 Mbp (579 bp) score=10
nasT response regulator NasT RGAI101:1.786..1.787 Mbp (621 bp) score=10
RGAI101_975 response regulator/sensor histidine kinase, putative RGAI101:1.795..1.797 Mbp (1.404 kbp) score=10
RGAI101_886 sensory box histidine kinase/response regulator RGAI101:1.803..1.805 Mbp (2.538 kbp) score=10
RGAI101_341 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.811..1.812 Mbp (1.269 kbp) score=10
RGAI101_961 ATP phosphoribosyltransferase regulatory subunit RGAI101:1.863..1.864 Mbp (1.08 kbp) score=10
RGAI101_974 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.883..1.884 Mbp (651 bp) score=10
RGAI101_920 chemotaxis response regulator, CheY4 RGAI101:1.897..1.898 Mbp (369 bp) score=10
RGAI101_713 [T] COG0784 FOG: CheY-like receiver; chemotaxis response regulator protein-glutamate methylesterase ofgroup 3 operon; EC_number=3.1.1.61 RGAI101:1.903..1.904 Mbp (1.107 kbp) score=10
RGAI101_757 sensory box histidine kinase/response regulator RGAI101:1.906..1.907 Mbp (696 bp) score=10
RGAI101_2776 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.926..1.926 Mbp (288 bp) score=10
soxA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.962..1.962 Mbp (855 bp) score=10
soxZ [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.962..1.963 Mbp (330 bp) score=10
RGAI101_744 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.973..1.973 Mbp (216 bp) score=10
RGAI101_2675 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:1.989..1.99 Mbp (489 bp) score=10
RGAI101_3681 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.013..2.013 Mbp (393 bp) score=10
RGAI101_1232 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.016..2.016 Mbp (471 bp) score=10
RGAI101_1600 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.067..2.067 Mbp (411 bp) score=10
RGAI101_574 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.069..2.07 Mbp (1.173 kbp) score=10
RGAI101_163 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.115..2.115 Mbp (183 bp) score=10
RGAI101_1217 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.123..2.125 Mbp (2.46 kbp) score=10
RGAI101_1428 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RGAI101:2.17..2.17 Mbp (774 bp) score=10
RGAI101_2545 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.172..2.174 Mbp (1.461 kbp) score=10
RGAI101_2164 response regulator receiver protein RGAI101:2.175..2.176 Mbp (1.239 kbp) score=10
RGAI101_2327 response regulator receiver protein RGAI101:2.191..2.191 Mbp (381 bp) score=10
RGAI101_3117 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.193..2.194 Mbp (588 bp) score=10
RGAI101_682 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.227..2.228 Mbp (1.161 kbp) score=10
RGAI101_3221 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.252..2.253 Mbp (483 bp) score=10
RGAI101_999 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.263..2.263 Mbp (582 bp) score=10
RGAI101_1177 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.281..2.282 Mbp (765 bp) score=10
RGAI101_1083 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; PRC-barrel, putative RGAI101:2.301..2.302 Mbp (948 bp) score=10
RGAI101_2694 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.321..2.323 Mbp (2.586 kbp) score=10
RGAI101_383 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; hemolysin-type calcium-binding region RGAI101:2.327..2.328 Mbp (999 bp) score=10
RGAI101_1879 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.34..2.341 Mbp (534 bp) score=10
RGAI101_1874 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.341..2.341 Mbp (222 bp) score=10
RGAI101_2339 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.341..2.343 Mbp (1.59 kbp) score=10
RGAI101_2183 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.372..2.372 Mbp (576 bp) score=10
sdh [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.421..2.422 Mbp (1.062 kbp) score=10
RGAI101_1652 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.423..2.424 Mbp (558 bp) score=10
RGAI101_1631 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.453..2.453 Mbp (510 bp) score=10
RGAI101_1624 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.453..2.454 Mbp (951 bp) score=10
RGAI101_2167 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.455..2.456 Mbp (495 bp) score=10
RGAI101_3073 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.465..2.465 Mbp (567 bp) score=10
RGAI101_2241 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.465..2.466 Mbp (597 bp) score=10
RGAI101_3141 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.477..2.478 Mbp (912 bp) score=10
RGAI101_2823 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.479..2.479 Mbp (411 bp) score=10
RGAI101_684 [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RGAI101:2.49..2.49 Mbp (342 bp) score=10
RGAI101_1141 [T] COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RGAI101:2.49..2.491 Mbp (453 bp) score=10
RGAI101_1413 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.509..2.51 Mbp (492 bp) score=10
RGAI101_938 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.521..2.522 Mbp (264 bp) score=10
RGAI101_664 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.527..2.529 Mbp (1.152 kbp) score=10
RGAI101_949 response regulator receiver domain protein RGAI101:2.532..2.533 Mbp (627 bp) score=10
RGAI101_1998 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.54..2.541 Mbp (396 bp) score=10
RGAI101_268 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.567..2.568 Mbp (630 bp) score=10
RGAI101_1519 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.574..2.577 Mbp (2.763 kbp) score=10
RGAI101_1769 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.577..2.579 Mbp (2.046 kbp) score=10
RGAI101_3539 sensor histidine kinase/response regulator RGAI101:2.586..2.589 Mbp (2.172 kbp) score=10
RGAI101_3017 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.592..2.593 Mbp (327 bp) score=10
RGAI101_3472 response regulator receiver domain protein RGAI101:2.617..2.618 Mbp (987 bp) score=10
RGAI101_2171 response regulator receiver domain protein RGAI101:2.618..2.619 Mbp (366 bp) score=10
RGAI101_2592 two-component hybrid sensor and regulator RGAI101:2.619..2.62 Mbp (1.59 kbp) score=10
RGAI101_1423 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.665..2.666 Mbp (579 bp) score=10
RGAI101_934 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.674..2.675 Mbp (717 bp) score=10
RGAI101_3259 [K] COG3327 Phenylacetic acid-responsive transcriptional repressor RGAI101:2.681..2.681 Mbp (771 bp) score=10
ptsN nitrogen regulatory IIA protein RGAI101:2.686..2.686 Mbp (465 bp) score=10
RGAI101_2011 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.688..2.689 Mbp (1.698 kbp) score=10
RGAI101_451 two-component response regulator RGAI101:2.731..2.732 Mbp (810 bp) score=10
RGAI101_2984 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; Tetratricopeptide repeat RGAI101:2.748..2.749 Mbp (1.377 kbp) score=10
RGAI101_3342 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.755..2.757 Mbp (1.461 kbp) score=10
RGAI101_2022 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.761..2.761 Mbp (342 bp) score=10
RGAI101_2864 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.764..2.766 Mbp (1.515 kbp) score=10
regA photosynthetic apparatus regulatory protein RegA RGAI101:2.784..2.785 Mbp (552 bp) score=10
RGAI101_3609 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; rb142 RGAI101:2.869..2.871 Mbp (2.121 kbp) score=10
RGAI101_896 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; rb134 RGAI101:2.885..2.887 Mbp (2.451 kbp) score=10
RGAI101_1701 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.892..2.893 Mbp (762 bp) score=10
RGAI101_2016 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.915..2.915 Mbp (207 bp) score=10
RGAI101_781 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.941..2.941 Mbp (531 bp) score=10
RGAI101_1425 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.947..2.948 Mbp (1.548 kbp) score=10
RGAI101_3090 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.974..2.975 Mbp (279 bp) score=10
RGAI101_3012 [N] COG5442 Flagellar biosynthesis regulator FlaF RGAI101:2.976..2.976 Mbp (267 bp) score=10
RGAI101_3532 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.977..2.978 Mbp (789 bp) score=10
flgK [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:2.996..2.997 Mbp (1.473 kbp) score=10
RGAI101_687 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.021..3.022 Mbp (948 bp) score=10
RGAI101_753 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.057..3.058 Mbp (624 bp) score=10
RGAI101_1890 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.058..3.06 Mbp (1.689 kbp) score=10
RGAI101_2627 nitrogen regulatory protein P-II RGAI101:3.066..3.066 Mbp (339 bp) score=10
RGAI101_274 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.084..3.084 Mbp (438 bp) score=10
ada ADA regulatory protein RGAI101:3.091..3.092 Mbp (882 bp) score=10
RGAI101_3257 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RGAI101:3.097..3.099 Mbp (1.974 kbp) score=10
RGAI101_2821 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.11..3.111 Mbp (258 bp) score=10
RGAI101_1345 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.137..3.138 Mbp (972 bp) score=10
RGAI101_3658 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.152..3.153 Mbp (327 bp) score=10
RGAI101_154 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.168..3.168 Mbp (279 bp) score=10
RGAI101_1266 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.172..3.172 Mbp (456 bp) score=10
RGAI101_294 response regulator RGAI101:3.196..3.197 Mbp (717 bp) score=10
RGAI101_2414 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.208..3.209 Mbp (1.185 kbp) score=10
RGAI101_3565 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.271..3.272 Mbp (423 bp) score=10
RGAI101_3700 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.274..3.274 Mbp (414 bp) score=10
RGAI101_3234 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.277..3.277 Mbp (186 bp) score=10
RGAI101_582 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.28..3.281 Mbp (276 bp) score=10
RGAI101_1457 [O] COG1764 Predicted redox protein, regulator of disulfide bond formation RGAI101:3.283..3.283 Mbp (450 bp) score=10
RGAI101_1641 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RGAI101:3.292..3.293 Mbp (702 bp) score=10
RGAI101_2589 sensory box histidine kinase/response regulator RGAI101:3.294..3.297 Mbp (2.361 kbp) score=10
RGAI101_2549 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.336..3.336 Mbp (582 bp) score=10
RGAI101_2073 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.351..3.352 Mbp (210 bp) score=10
RGAI101_1463 response regulator receiver protein RGAI101:3.378..3.379 Mbp (369 bp) score=10
RGAI101_3303 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.452..3.453 Mbp (924 bp) score=10
RGAI101_2401 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.485..3.485 Mbp (519 bp) score=10
RGAI101_412 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.55..3.55 Mbp (222 bp) score=10
RGAI101_1364 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.564..3.565 Mbp (1.14 kbp) score=10
RGAI101_1001 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.565..3.567 Mbp (1.797 kbp) score=10
RGAI101_782 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.594..3.595 Mbp (225 bp) score=10
RGAI101_955 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.596..3.596 Mbp (861 bp) score=10
RGAI101_3430 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.6..3.601 Mbp (684 bp) score=10
RGAI101_3466 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.628..3.63 Mbp (1.326 kbp) score=10
RGAI101_3608 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.635..3.636 Mbp (690 bp) score=10
RGAI101_670 transcription regulator, LuxR family, putative RGAI101:3.644..3.645 Mbp (747 bp) score=10
RGAI101_1760 response regulator receiver domain protein RGAI101:3.682..3.683 Mbp (729 bp) score=10
RGAI101_2872 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.689..3.689 Mbp (351 bp) score=10
RGAI101_275 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.708..3.709 Mbp (765 bp) score=10
RGAI101_3353 response regulator receiver domain protein, putative RGAI101:3.726..3.727 Mbp (1.128 kbp) score=10
RGAI101_3059 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.733..3.733 Mbp (270 bp) score=10
RGAI101_381 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.738..3.739 Mbp (528 bp) score=10
RGAI101_3398 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.74..3.741 Mbp (291 bp) score=10
RGAI101_1273 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.778..3.781 Mbp (2.859 kbp) score=10
RGAI101_1548 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.81..3.81 Mbp (789 bp) score=10
RGAI101_1617 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.811..3.813 Mbp (1.44 kbp) score=10
RGAI101_408 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.857..3.858 Mbp (696 bp) score=10
RGAI101_2834 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.891..3.893 Mbp (1.311 kbp) score=10
RGAI101_1106 sensory box sensor histidine kinase/response regulator RGAI101:3.894..3.896 Mbp (2.217 kbp) score=10
RGAI101_678 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.923..3.923 Mbp (468 bp) score=10
RGAI101_3756 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.94..3.941 Mbp (579 bp) score=10
RGAI101_3976 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.975..3.975 Mbp (132 bp) score=10
RGAI101_3949 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:3.995..3.996 Mbp (450 bp) score=10
RGAI101_3894 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4..4.001 Mbp (606 bp) score=10
RGAI101_3856 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.032..4.032 Mbp (216 bp) score=10
RGAI101_3955 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RGAI101:4.032..4.033 Mbp (654 bp) score=10
RGAI101_3930 sensor histidine kinase/response regulator RGAI101:4.04..4.042 Mbp (1.551 kbp) score=10
fixK [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RGAI101:4.043..4.043 Mbp (675 bp) score=10
RGAI101_3902 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.044..4.045 Mbp (1.182 kbp) score=10
RGAI101_3776 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.05..4.051 Mbp (432 bp) score=10
RGAI101_3938 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.052..4.053 Mbp (831 bp) score=10
RGAI101_3937 sensory box sensor histidine kinase/response regulator RGAI101:4.058..4.063 Mbp (4.467 kbp) score=10
coxE [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.07..4.072 Mbp (1.188 kbp) score=10
RGAI101_3959 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.11..4.111 Mbp (912 bp) score=10
RGAI101_3784 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.111..4.113 Mbp (1.395 kbp) score=10
RGAI101_3935 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.131..4.132 Mbp (861 bp) score=10
RGAI101_3965 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.148..4.148 Mbp (576 bp) score=10
RGAI101_3925 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.156..4.157 Mbp (675 bp) score=10
RGAI101_3843 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.161..4.162 Mbp (966 bp) score=10
RGAI101_3973 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.172..4.173 Mbp (1.353 kbp) score=10
RGAI101_3931 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.198..4.198 Mbp (300 bp) score=10
RGAI101_3800 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.198..4.199 Mbp (1.35 kbp) score=10
RGAI101_3998 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.211..4.212 Mbp (951 bp) score=10
RGAI101_4018 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.248..4.248 Mbp (468 bp) score=10
RGAI101_4070 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; contains weak similarity to succinyl-CoA synthetase alpha subunit RGAI101:4.26..4.261 Mbp (1.488 kbp) score=10
RGAI101_4076 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.262..4.262 Mbp (585 bp) score=10
RGAI101_4008 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.262..4.263 Mbp (585 bp) score=10
RGAI101_4243 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.322..4.323 Mbp (1.038 kbp) score=10
RGAI101_4014 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.343..4.344 Mbp (1.038 kbp) score=10
RGAI101_4025 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.356..4.357 Mbp (621 bp) score=10
RGAI101_4199 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.381..4.382 Mbp (696 bp) score=10
RGAI101_4245 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.382..4.382 Mbp (390 bp) score=10
RGAI101_4069 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.384..4.385 Mbp (1.068 kbp) score=10
RGAI101_4033 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.403..4.407 Mbp (4.152 kbp) score=10
RGAI101_4052 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.421..4.421 Mbp (582 bp) score=10
RGAI101_4116 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.423..4.428 Mbp (4.851 kbp) score=10
RGAI101_4254 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.444..4.444 Mbp (381 bp) score=10
RGAI101_4042 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RGAI101:4.503..4.504 Mbp (1.419 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70