Roseobase: Roseobacter sp. GAI101

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RGAI101:500000..600000, pyrF, RGAI101_4201, ZP_05102392, tRNA-Leu, transcriptional regulator, QPGEKPRLPAPVVLLAQSEPGYENLMKLNSCLYIDKGGALPE.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 115 regions match your request.
Matches on RGAI101
overview_RGAI101
gatA glutamyl-tRNA(Gln) amidotransferase, A subunit [J] COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases RGAI101:1.681..1.682 Mbp (1.488 kbp) score=30
gatC glutamyl-tRNA(Gln) amidotransferase, C subunit [J] COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit RGAI101:1.682..1.683 Mbp (288 bp) score=30
RGAI101_2206 glutamyl-tRNA(Gln) amidotransferase subunit A [J] COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases RGAI101:1.749..1.75 Mbp (1.341 kbp) score=30
RGAI101_3720 tRNA-OTHER tRNA-Pseudo RGAI101:156.4..156.5 kbp (84 bp) score=20
glyQ glycyl-tRNA synthetase, alpha subunit [J] COG0752 Glycyl-tRNA synthetase, alpha subunit RGAI101:248.7..249.6 kbp (939 bp) score=20
glyS glycyl-tRNA synthetase, beta subunit [J] COG0751 Glycyl-tRNA synthetase, beta subunit RGAI101:250.2..252.5 kbp (2.229 kbp) score=20
gatB glutamyl-tRNA(Gln) amidotransferase, B subunit [J] COG2511 Archaeal Glu-tRNAGln amidotransferase subunit E (contains GAD domain) RGAI101:321..322.1 kbp (1.11 kbp) score=20
gltX_1 glutamyl-tRNA synthetase [J] COG0008 Glutamyl- and glutaminyl-tRNA synthetases RGAI101:447.5..448.9 kbp (1.401 kbp) score=20
cysS cysteinyl-tRNA synthetase [J] COG0215 Cysteinyl-tRNA synthetase RGAI101:542.8..544.3 kbp (1.446 kbp) score=20
argS arginyl-tRNA synthetase [J] COG0018 Arginyl-tRNA synthetase RGAI101:555.4..557.1 kbp (1.743 kbp) score=20
tyrS tyrosyl-tRNA synthetase [J] COG0162 Tyrosyl-tRNA synthetase RGAI101:570.1..571.4 kbp (1.251 kbp) score=20
serS seryl-tRNA synthetase [J] COG0172 Seryl-tRNA synthetase RGAI101:639.2..640.4 kbp (1.293 kbp) score=20
dusB tRNA-dihydrouridine synthase B [J] COG0042 tRNA-dihydrouridine synthase RGAI101:868.1..869.1 kbp (987 bp) score=20
RGAI101_3422 glutamyl-tRNA synthetase [J] COG0008 Glutamyl- and glutaminyl-tRNA synthetases RGAI101:896.4..897.3 kbp (840 bp) score=20
miaA tRNA delta(2)-isopentenylpyrophosphate transferase [J] COG0324 tRNA delta(2)-isopentenylpyrophosphate transferase RGAI101:917.2..918.1 kbp (891 bp) score=20
ate arginine-tRNA-protein transferase [O] COG2935 Putative arginyl-tRNA:protein arginylyltransferase RGAI101:966.9..967.7 kbp (786 bp) score=20
RGAI101_2530 [J] COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases RGAI101:980.4..981.8 kbp (1.398 kbp) score=20
tgt queuine tRNA-ribosyltransferase [J] COG0343 Queuine/archaeosine tRNA-ribosyltransferase RGAI101:1.096..1.097 Mbp (1.128 kbp) score=20
queA S-adenosylmethionine:tRNA ribosyltransferase-isomerase [J] COG0809 S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) RGAI101:1.151..1.152 Mbp (1.077 kbp) score=20
aat leucyl/phenylalanyl-tRNA--protein transferase [O] COG2360 Leu/Phe-tRNA-protein transferase RGAI101:1.211..1.211 Mbp (636 bp) score=20
atzF [J] COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases RGAI101:1.513..1.515 Mbp (1.797 kbp) score=20
thrS threonyl-tRNA synthetase [J] COG0442 Prolyl-tRNA synthetase RGAI101:1.598..1.6 Mbp (1.947 kbp) score=20
proS prolyl-tRNA synthetase [J] COG0441 Threonyl-tRNA synthetase RGAI101:1.629..1.63 Mbp (1.341 kbp) score=20
dtd D-tyrosyl-tRNA(Tyr) deacylase [J] COG1490 D-Tyr-tRNAtyr deacylase RGAI101:1.693..1.694 Mbp (444 bp) score=20
RGAI101_1263 tryptophanyl-tRNA synthetase [J] COG0180 Tryptophanyl-tRNA synthetase RGAI101:1.858..1.858 Mbp (294 bp) score=20
ileS isoleucyl-tRNA synthetase [J] COG0495 Leucyl-tRNA synthetase RGAI101:2.139..2.142 Mbp (2.916 kbp) score=20
pth peptidyl-tRNA hydrolase [J] COG0193 Peptidyl-tRNA hydrolase RGAI101:2.259..2.26 Mbp (717 bp) score=20
selA L-seryl-tRNA selenium transferase [E] COG1921 Selenocysteine synthase [seryl-tRNASer selenium transferase] RGAI101:2.345..2.346 Mbp (1.392 kbp) score=20
RGAI101_2269 [J] COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases RGAI101:2.499..2.501 Mbp (1.329 kbp) score=20
leuS leucyl-tRNA synthetase [J] COG0525 Valyl-tRNA synthetase RGAI101:2.51..2.513 Mbp (2.547 kbp) score=20
cca tRNA nucleotidyltransferase [J] COG0617 tRNA nucleotidyltransferase/poly(A) polymerase RGAI101:2.837..2.838 Mbp (1.185 kbp) score=20
pheS phenylalanyl-tRNA synthetase, alpha subunit [J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit RGAI101:3.167..3.168 Mbp (1.074 kbp) score=20
pheT phenylalanyl-tRNA synthetase, beta subunit [J] COG0072 Phenylalanyl-tRNA synthetase beta subunit RGAI101:3.169..3.171 Mbp (2.4 kbp) score=20
trpS tryptophanyl-tRNA synthetase [J] COG0162 Tyrosyl-tRNA synthetase RGAI101:3.201..3.202 Mbp (1.071 kbp) score=20
gltX_2 glutamyl-tRNA synthetase [J] COG0008 Glutamyl- and glutaminyl-tRNA synthetases RGAI101:3.238..3.239 Mbp (1.326 kbp) score=20
lysS lysyl-tRNA synthetase [J] COG1384 Lysyl-tRNA synthetase (class I) RGAI101:3.272..3.273 Mbp (1.611 kbp) score=20
trmD tRNA (guanine-N1)-methyltransferase [J] COG0336 tRNA-(guanine-N1)-methyltransferase RGAI101:3.361..3.362 Mbp (738 bp) score=20
valS valyl-tRNA synthetase [J] COG0060 Isoleucyl-tRNA synthetase RGAI101:3.832..3.835 Mbp (3.078 kbp) score=20
metG methionyl-tRNA synthetase [J] COG0143 Methionyl-tRNA synthetase RGAI101:3.881..3.883 Mbp (1.713 kbp) score=20
RGAI101_3743 tRNA-Gly RGAI101:163.5..163.6 kbp (75 bp) score=10
RGAI101_2121 [J] COG0144 tRNA and rRNA cytosine-C5-methylases RGAI101:414.4..414.8 kbp (378 bp) score=10
RGAI101_3749 tRNA-Pro RGAI101:467.4..467.4 kbp (77 bp) score=10
RGAI101_3734 tRNA-Pro RGAI101:562.2..562.2 kbp (77 bp) score=10
RGAI101_3366 tRNA-dihydrouridine synthase A RGAI101:612.3..613.3 kbp (1.038 kbp) score=10
RGAI101_2444 [J] COG0223 Methionyl-tRNA formyltransferase RGAI101:653.1..653.5 kbp (339 bp) score=10
RGAI101_3730 tRNA-Leu RGAI101:654.7..654.7 kbp (84 bp) score=10
RGAI101_3729 tRNA-Met RGAI101:656.5..656.6 kbp (77 bp) score=10
purN [J] COG0223 Methionyl-tRNA formyltransferase RGAI101:657.8..658.4 kbp (597 bp) score=10
RGAI101_3115 [J] COG0013 Alanyl-tRNA synthetase RGAI101:697.8..698.5 kbp (720 bp) score=10
RGAI101_3737 tRNA-Ser RGAI101:698.6..698.7 kbp (90 bp) score=10
RGAI101_3723 tRNA-Ser RGAI101:791.5..791.6 kbp (91 bp) score=10
trmFO tRNA:m(5)U-54 methyltransferase RGAI101:895.1..896.4 kbp (1.383 kbp) score=10
RGAI101_3712 tRNA-Leu RGAI101:949.5..949.6 kbp (84 bp) score=10
RGAI101_3716 tRNA-Asp RGAI101:999.1..999.1 kbp (77 bp) score=10
RGAI101_3748 tRNA-Asp RGAI101:1.006..1.006 Mbp (77 bp) score=10
RGAI101_3739 tRNA-Arg RGAI101:1.018..1.018 Mbp (77 bp) score=10
alaS alanyl-tRNA synthetase RGAI101:1.035..1.037 Mbp (2.658 kbp) score=10
sun [J] COG0144 tRNA and rRNA cytosine-C5-methylases RGAI101:1.042..1.043 Mbp (1.161 kbp) score=10
RGAI101_3731 tRNA-Gly RGAI101:1.062..1.062 Mbp (74 bp) score=10
RGAI101_3719 tRNA-Val RGAI101:1.091..1.091 Mbp (76 bp) score=10
RGAI101_3718 tRNA-Thr RGAI101:1.237..1.237 Mbp (76 bp) score=10
RGAI101_3711 tRNA-Ala RGAI101:1.296..1.296 Mbp (76 bp) score=10
RGAI101_3727 tRNA-Ile RGAI101:1.296..1.296 Mbp (77 bp) score=10
RGAI101_3715 tRNA-Ser RGAI101:1.311..1.311 Mbp (90 bp) score=10
RGAI101_3741 tRNA-Asn RGAI101:1.38..1.38 Mbp (75 bp) score=10
RGAI101_3724 tRNA-Glu RGAI101:1.562..1.562 Mbp (75 bp) score=10
tadA tRNA-specific adenosine deaminase RGAI101:1.684..1.685 Mbp (456 bp) score=10
RGAI101_3726 tRNA-Gly RGAI101:1.716..1.716 Mbp (75 bp) score=10
RGAI101_961 [J] COG0124 Histidyl-tRNA synthetase RGAI101:1.863..1.864 Mbp (1.08 kbp) score=10
hisS histidyl-tRNA synthetase RGAI101:1.864..1.865 Mbp (1.509 kbp) score=10
RGAI101_3733 tRNA-Gln RGAI101:1.896..1.896 Mbp (75 bp) score=10
RGAI101_3742 tRNA-Thr RGAI101:2.018..2.018 Mbp (75 bp) score=10
RGAI101_3740 tRNA-Phe RGAI101:2.131..2.131 Mbp (75 bp) score=10
truA tRNA pseudouridine synthase A RGAI101:2.145..2.146 Mbp (771 bp) score=10
tilS tRNA(Ile)-lysidine synthetase RGAI101:2.196..2.197 Mbp (1.26 kbp) score=10
RGAI101_3717 tRNA-Ser RGAI101:2.254..2.255 Mbp (90 bp) score=10
RGAI101_722 MiaB-like tRNA modifying enzyme YliG, TIGR01125 RGAI101:2.267..2.268 Mbp (1.371 kbp) score=10
RGAI101_3722 tRNA-Sec RGAI101:2.343..2.343 Mbp (91 bp) score=10
RGAI101_3732 tRNA-Ala RGAI101:2.383..2.383 Mbp (76 bp) score=10
RGAI101_3746 tRNA-Ile RGAI101:2.383..2.383 Mbp (77 bp) score=10
RGAI101_3745 tRNA-Val RGAI101:2.395..2.395 Mbp (75 bp) score=10
RGAI101_1604 [J] COG0144 tRNA and rRNA cytosine-C5-methylases RGAI101:2.447..2.449 Mbp (1.272 kbp) score=10
RGAI101_2477 tRNA pseudouridine synthase B RGAI101:2.452..2.453 Mbp (834 bp) score=10
RGAI101_3713 tRNA-Arg RGAI101:2.607..2.607 Mbp (77 bp) score=10
RGAI101_3747 tRNA-Lys RGAI101:2.624..2.624 Mbp (76 bp) score=10
RGAI101_1388 MiaB-like tRNA modifying enzyme RGAI101:2.625..2.626 Mbp (1.257 kbp) score=10
RGAI101_3735 tRNA-Leu RGAI101:2.674..2.674 Mbp (86 bp) score=10
trmE tRNA modification GTPase TrmE RGAI101:2.81..2.811 Mbp (1.287 kbp) score=10
gidA tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA RGAI101:2.811..2.813 Mbp (1.872 kbp) score=10
rumA [J] COG2265 SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase RGAI101:2.842..2.843 Mbp (1.206 kbp) score=10
RGAI101_1039 peptidyl-tRNA hydrolase domain protein RGAI101:2.989..2.989 Mbp (423 bp) score=10
RGAI101_2627 [J] COG0223 Methionyl-tRNA formyltransferase RGAI101:3.066..3.066 Mbp (339 bp) score=10
purU [J] COG0223 Methionyl-tRNA formyltransferase RGAI101:3.087..3.088 Mbp (984 bp) score=10
RGAI101_3738 tRNA-Ala RGAI101:3.152..3.152 Mbp (76 bp) score=10
aspS [J] COG0017 Aspartyl/asparaginyl-tRNA synthetases RGAI101:3.192..3.194 Mbp (1.851 kbp) score=10
glnD [J] COG0617 tRNA nucleotidyltransferase/poly(A) polymerase RGAI101:3.205..3.208 Mbp (2.787 kbp) score=10
RGAI101_3736 tRNA-Met RGAI101:3.333..3.333 Mbp (77 bp) score=10
def_1 [J] COG0242 N-formylmethionyl-tRNA deformylase; overlaps another CDS with the same product name RGAI101:3.381..3.382 Mbp (525 bp) score=10
def_2 [J] COG0242 N-formylmethionyl-tRNA deformylase; overlaps another CDS with the same product name RGAI101:3.382..3.382 Mbp (480 bp) score=10
def_3 [J] COG0242 N-formylmethionyl-tRNA deformylase; overlaps another CDS with the same product name RGAI101:3.382..3.383 Mbp (498 bp) score=10
fmt methionyl-tRNA formyltransferase RGAI101:3.383..3.384 Mbp (915 bp) score=10
RGAI101_3744 tRNA-Trp RGAI101:3.424..3.424 Mbp (76 bp) score=10
RGAI101_3714 tRNA-Arg RGAI101:3.49..3.49 Mbp (77 bp) score=10
miaB tRNA-i(6)A37 thiotransferase enzyme MiaB RGAI101:3.674..3.675 Mbp (1.389 kbp) score=10
trmB tRNA (guanine-N(7)-)-methyltransferase RGAI101:3.683..3.684 Mbp (702 bp) score=10
RGAI101_3725 tRNA-Cys RGAI101:3.723..3.723 Mbp (74 bp) score=10
RGAI101_3728 tRNA-Leu RGAI101:3.846..3.846 Mbp (87 bp) score=10
RGAI101_3721 tRNA-His RGAI101:3.925..3.925 Mbp (77 bp) score=10
RGAI101_3994 tRNA-Ala RGAI101:3.949..3.949 Mbp (76 bp) score=10
RGAI101_3991 tRNA-Ile RGAI101:3.949..3.95 Mbp (77 bp) score=10
ybbB tRNA 2-selenouridine synthase RGAI101:3.959..3.96 Mbp (1.035 kbp) score=10
RGAI101_3995 tRNA-Arg RGAI101:3.964..3.964 Mbp (77 bp) score=10
RGAI101_3992 tRNA-Met RGAI101:3.985..3.985 Mbp (77 bp) score=10
RGAI101_3990 tRNA-Ala RGAI101:4.207..4.207 Mbp (76 bp) score=10
RGAI101_3993 tRNA-Ile RGAI101:4.207..4.207 Mbp (77 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70