Roseobase: Sagittula stellata E-37

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: SSE37:300000..400000, SSE37_08023, anmK, ZP_01748880, SSE37_t24878, SSE37_r21240, translation initiation factor, MAVLQGGFGGLLIKARYYMGFTKRIPEPLSATRSRFAFGEYDEVIIDGISYRPSESNEFG.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 105 regions match your request.
Matches on SSE37
overview_SSE37
infC translation initiation factor IF-3 COG0290 Translation initiation factor 3 (IF-3) SSE37:845.6..846.1 kbp (414 bp) score=60
SSE37_18477 translation initiation factor IF-2 COG0532 Translation initiation factor 2 (IF-2; GTPase) SSE37:3.825..3.828 Mbp (2.511 kbp) score=60
SSE37_22527 elongation factor P COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) SSE37:4.669..4.67 Mbp (564 bp) score=60
infA translation initiation factor IF-1 COG0361 Translation initiation factor 1 (IF-1) SSE37:4.791..4.791 Mbp (219 bp) score=60
SSE37_00475 putative translation initiation inhibitor protein, yjgF family COG0251 Putative translation initiation inhibitor, yjgF family SSE37:84.33..84.85 kbp (522 bp) score=40
SSE37_02495 putative translation initiation inhibitor COG0251 Putative translation initiation inhibitor, yjgF family SSE37:495.9..496.3 kbp (423 bp) score=40
SSE37_12921 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB SSE37:2.644..2.645 Mbp (393 bp) score=40
SSE37_15061 translation elongation factor Tu COG0050 GTPases - translation elongation factors SSE37:3.103..3.104 Mbp (1.176 kbp) score=40
SSE37_15066 translation elongation factor G COG0480 Translation elongation factors (GTPases) SSE37:3.104..3.106 Mbp (2.124 kbp) score=40
SSE37_15181 translation elongation factor Tu COG0050 GTPases - translation elongation factors SSE37:3.129..3.131 Mbp (1.176 kbp) score=40
tsf elongation factor Ts COG0264 Translation elongation factor Ts SSE37:1.25..1.251 Mbp (461 bp) score=30
SSE37_09983 translation-associated GTPase COG0012 Predicted GTPase, probable translation factor SSE37:2.061..2.062 Mbp (1.086 kbp) score=30
SSE37_11159 COG0532 Translation initiation factor 2 (IF-2; GTPase) SSE37:2.293..2.295 Mbp (1.542 kbp) score=30
SSE37_11694 Antisigma-factor antagonist (STAS) domain protein COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) SSE37:2.397..2.397 Mbp (330 bp) score=30
SSE37_17740 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) SSE37:3.652..3.653 Mbp (663 bp) score=30
fliN translation initiation factor IF-2 SSE37:3.825..3.825 Mbp (141 bp) score=30
SSE37_00155 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:22.77..23.19 kbp (423 bp) score=20
SSE37_00700 Plasmid replication initiation protein COG5527 Protein involved in initiation of plasmid replication SSE37:130.3..131.4 kbp (1.143 kbp) score=20
SSE37_01305 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:260..260.4 kbp (348 bp) score=20
SSE37_03580 molybdenum cofactor biosynthesis protein A COG2896 Molybdenum cofactor biosynthesis enzyme SSE37:731.7..732.7 kbp (1.008 kbp) score=20
SSE37_04510 ribosome recycling factor COG0233 Ribosome recycling factor SSE37:917.1..917.6 kbp (561 bp) score=20
SSE37_04875 COG0480 Translation elongation factors (GTPases) SSE37:983.2..985.3 kbp (2.118 kbp) score=20
SSE37_05200 transcription-repair coupling factor COG1197 Transcription-repair coupling factor (superfamily II helicase) SSE37:1.07..1.074 Mbp (3.48 kbp) score=20
SSE37_05350 peptide chain release factor 2 COG1186 Protein chain release factor B SSE37:1.104..1.105 Mbp (1.125 kbp) score=20
SSE37_05822 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:1.203..1.204 Mbp (444 bp) score=20
SSE37_06854 molybdenum cofactor biosynthesis protein C COG0315 Molybdenum cofactor biosynthesis enzyme SSE37:1.412..1.413 Mbp (477 bp) score=20
SSE37_07203 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:1.486..1.486 Mbp (465 bp) score=20
SSE37_07593 peptide chain release factor 3 COG4108 Peptide chain release factor RF-3 SSE37:1.572..1.574 Mbp (1.599 kbp) score=20
SSE37_08208 peptide chain release factor 1 COG0216 Protein chain release factor A SSE37:1.697..1.698 Mbp (1.05 kbp) score=20
tig trigger factor COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) SSE37:1.714..1.716 Mbp (1.329 kbp) score=20
SSE37_10163 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) SSE37:2.094..2.094 Mbp (297 bp) score=20
SSE37_10662 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:2.198..2.199 Mbp (369 bp) score=20
SSE37_11839 ribosome-binding factor A COG0858 Ribosome-binding factor A SSE37:2.429..2.429 Mbp (342 bp) score=20
SSE37_12811 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:2.625..2.625 Mbp (429 bp) score=20
SSE37_14774 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:3.041..3.041 Mbp (333 bp) score=20
SSE37_16043 Anti-sigma factor ChrR COG3806 Anti-sigma factor SSE37:3.297..3.298 Mbp (651 bp) score=20
rho transcription termination factor Rho COG1158 Transcription termination factor SSE37:3.507..3.509 Mbp (1.281 kbp) score=20
SSE37_17298 chromosomal replication initiation protein COG0593 ATPase involved in DNA replication initiation SSE37:3.554..3.556 Mbp (1.38 kbp) score=20
SSE37_18487 transcription elongation factor NusA COG0195 Transcription elongation factor SSE37:3.829..3.83 Mbp (1.617 kbp) score=20
SSE37_19147 anti-sigma factor, ChrR COG3806 Anti-sigma factor SSE37:3.996..3.997 Mbp (660 bp) score=20
SSE37_19947 COG0009 Putative translation factor (SUA5) SSE37:4.146..4.147 Mbp (987 bp) score=20
SSE37_20027 transcription elongation factor GreA COG0782 Transcription elongation factor SSE37:4.161..4.161 Mbp (471 bp) score=20
SSE37_20547 xanthine dehydrogenase accessory factor COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family SSE37:4.263..4.264 Mbp (945 bp) score=20
SSE37_20852 COG0251 Putative translation initiation inhibitor, yjgF family SSE37:4.331..4.332 Mbp (729 bp) score=20
SSE37_20917 molybdopterin converting factor, subunit 2 COG0314 Molybdopterin converting factor, large subunit SSE37:4.345..4.345 Mbp (441 bp) score=20
SSE37_20922 putative molybdopterin MPT converting factor, subunit 1 protein COG1977 Molybdopterin converting factor, small subunit SSE37:4.345..4.346 Mbp (246 bp) score=20
SSE37_22307 hydrogenase maturation factor F COG0068 Hydrogenase maturation factor SSE37:4.628..4.63 Mbp (2.199 kbp) score=20
SSE37_23269 transcription antitermination factor NusB COG0781 Transcription termination factor SSE37:4.805..4.805 Mbp (507 bp) score=20
SSE37_00730 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:137.1..138 kbp (897 bp) score=10
SSE37_00735 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:138..139 kbp (966 bp) score=10
SSE37_00745 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) SSE37:139.3..140.2 kbp (918 bp) score=10
SSE37_02900 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) SSE37:576.7..577.4 kbp (771 bp) score=10
SSE37_02910 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:577.9..578.9 kbp (972 bp) score=10
SSE37_02915 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:578.9..581 kbp (2.103 kbp) score=10
SSE37_03860 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor SSE37:781.1..781.9 kbp (783 bp) score=10
SSE37_04120 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family SSE37:841.7..842.7 kbp (969 bp) score=10
SSE37_04365 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation SSE37:891.4..892.7 kbp (1.359 kbp) score=10
SSE37_04690 integration host factor, alpha subunit SSE37:953.2..953.5 kbp (303 bp) score=10
SSE37_05757 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain SSE37:1.189..1.19 Mbp (975 bp) score=10
SSE37_05812 COG1977 Molybdopterin converting factor, small subunit SSE37:1.201..1.202 Mbp (249 bp) score=10
SSE37_06429 COG0233 Ribosome recycling factor SSE37:1.321..1.321 Mbp (720 bp) score=10
SSE37_06654 COG1923 Uncharacterized host factor I protein SSE37:1.373..1.373 Mbp (237 bp) score=10
SSE37_06859 molybdenum cofactor biosynthesis protein A SSE37:1.413..1.414 Mbp (1.119 kbp) score=10
SSE37_06894 COG1138 Cytochrome c biogenesis factor SSE37:1.421..1.423 Mbp (1.968 kbp) score=10
SSE37_07073 iron-sulfur cluster assembly transcription factor IscR, putative SSE37:1.457..1.457 Mbp (465 bp) score=10
SSE37_07623 COG3552 Protein containing von Willebrand factor type A (vWA) domain SSE37:1.581..1.582 Mbp (1.251 kbp) score=10
SSE37_08203 COG2890 Methylase of polypeptide chain release factors SSE37:1.696..1.697 Mbp (846 bp) score=10
SSE37_08803 COG0593 ATPase involved in DNA replication initiation SSE37:1.813..1.814 Mbp (702 bp) score=10
SSE37_09848 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:2.035..2.036 Mbp (930 bp) score=10
SSE37_09853 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:2.036..2.037 Mbp (957 bp) score=10
SSE37_09863 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) SSE37:2.037..2.038 Mbp (810 bp) score=10
SSE37_10809 RNA polymerase sigma factor RpoD SSE37:2.223..2.225 Mbp (2.004 kbp) score=10
SSE37_10864 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:2.234..2.236 Mbp (1.845 kbp) score=10
SSE37_11699 anti-sigma B factor, putative SSE37:2.397..2.398 Mbp (471 bp) score=10
SSE37_12089 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase SSE37:2.478..2.48 Mbp (2.19 kbp) score=10
SSE37_12911 RNA polymerase sigma factor SSE37:2.643..2.643 Mbp (591 bp) score=10
SSE37_13618 molybdenum cofactor biosynthesis domain protein SSE37:2.797..2.798 Mbp (792 bp) score=10
SSE37_15136 transcription termination/antitermination factor NusG SSE37:3.123..3.124 Mbp (549 bp) score=10
SSE37_15356 COG0728 Uncharacterized membrane protein, putative virulence factor SSE37:3.164..3.165 Mbp (1.554 kbp) score=10
SSE37_16038 RNA polymerase sigma-70 factor SSE37:3.296..3.297 Mbp (687 bp) score=10
SSE37_16458 RNA polymerase sigma factor SSE37:3.377..3.378 Mbp (555 bp) score=10
SSE37_16603 COG1186 Protein chain release factor B SSE37:3.415..3.415 Mbp (435 bp) score=10
dnaA chromosomal replication initiation protein SSE37:3.554..3.554 Mbp (201 bp) score=10
SSE37_18135 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:3.75..3.752 Mbp (2.133 kbp) score=10
SSE37_18215 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) SSE37:3.771..3.772 Mbp (876 bp) score=10
rpoH2 RNA polymerase sigma-32 factor SSE37:3.978..3.979 Mbp (834 bp) score=10
SSE37_19922 molybdenum cofactor biosynthesis protein B SSE37:4.138..4.139 Mbp (543 bp) score=10
SSE37_20217 COG3806 Anti-sigma factor SSE37:4.196..4.197 Mbp (342 bp) score=10
SSE37_20512 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:4.257..4.257 Mbp (660 bp) score=10
ihfB integration host factor subunit beta SSE37:4.412..4.412 Mbp (312 bp) score=10
SSE37_21310 integration host factor beta subunit SSE37:4.413..4.413 Mbp (282 bp) score=10
SSE37_21535 COG3552 Protein containing von Willebrand factor type A (vWA) domain SSE37:4.461..4.462 Mbp (1.098 kbp) score=10
SSE37_22332 COG0680 Ni,Fe-hydrogenase maturation factor SSE37:4.635..4.635 Mbp (609 bp) score=10
SSE37_22387 COG0298 Hydrogenase maturation factor SSE37:4.641..4.642 Mbp (315 bp) score=10
SSE37_22392 COG0409 Hydrogenase maturation factor SSE37:4.642..4.643 Mbp (1.143 kbp) score=10
SSE37_22397 COG0309 Hydrogenase maturation factor SSE37:4.643..4.644 Mbp (1.023 kbp) score=10
SSE37_22959 COG3175 Cytochrome oxidase assembly factor SSE37:4.747..4.747 Mbp (615 bp) score=10
SSE37_22969 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) SSE37:4.747..4.748 Mbp (960 bp) score=10
SSE37_23414 RNA polymerase sigma factor SSE37:4.831..4.832 Mbp (897 bp) score=10
SSE37_23824 RNA polymerase sigma factor SSE37:4.917..4.917 Mbp (552 bp) score=10
SSE37_23919 chromosome replication initiation inhibitor protein SSE37:4.935..4.936 Mbp (873 bp) score=10
SSE37_24154 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain SSE37:4.988..4.988 Mbp (747 bp) score=10
SSE37_24704 COG4235 Cytochrome c biogenesis factor SSE37:5.12..5.121 Mbp (1.227 kbp) score=10
SSE37_24908 von Willebrand factor, type A SSE37:5.163..5.164 Mbp (1.041 kbp) score=10
SSE37_24913 von Willebrand factor, type A SSE37:5.164..5.165 Mbp (1.05 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70