Roseobase: Ruegeria lacuscaerulensis ITI-1157

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: SL1157:300000..400000, SL1157_1484, SL1157_A0004, pta, ZP_05784655, transcriptional regulator, TADIFTFQDHIVSSIVATVEPSVQSAEAANLVTRPTESLDAYDCVLRGLPELYRFEGQ.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 180 regions match your request.
Matches on SL1157
overview_SL1157
SL1157_2686 sigma-54 dependent transcriptional regulator/response regulator SL1157:2.54..2.541 Mbp (1.41 kbp) score=30
SL1157_0083 transcriptional regulator, XRE family SL1157:72.49..73.89 kbp (1.401 kbp) score=20
SL1157_0106 transcriptional regulator, LysR family SL1157:95.35..96.3 kbp (954 bp) score=20
SL1157_0176 transcriptional regulator, LysR family SL1157:165.2..166.1 kbp (906 bp) score=20
SL1157_0244 transcriptional regulator, LysR family SL1157:230.8..231.7 kbp (915 bp) score=20
SL1157_0252 transcriptional regulator, LysR family SL1157:245.1..246 kbp (882 bp) score=20
SL1157_0278 transcriptional regulator, Fur family SL1157:270.7..271.1 kbp (420 bp) score=20
SL1157_0292 transcriptional regulator, ArsR family SL1157:282.6..283 kbp (342 bp) score=20
SL1157_0295 transcriptional regulator, AsnC family SL1157:286.6..287 kbp (462 bp) score=20
SL1157_0299 transcriptional regulator, TetR family SL1157:292.7..293.4 kbp (687 bp) score=20
SL1157_0346 transcriptional regulator, TetR family SL1157:343.3..343.9 kbp (597 bp) score=20
SL1157_0386 transcriptional regulator, AlpA family SL1157:388.3..388.5 kbp (198 bp) score=20
SL1157_0411 transcriptional regulator, LysR family SL1157:407.7..408.6 kbp (903 bp) score=20
SL1157_0410 transcriptional regulator, LysR family SL1157:408.6..409.4 kbp (861 bp) score=20
SL1157_0417 transcriptional regulator, LysR family SL1157:415..415.9 kbp (897 bp) score=20
SL1157_0422 transcriptional regulator, TetR family SL1157:419..419.5 kbp (564 bp) score=20
SL1157_0427 transcriptional regulator, TetR family SL1157:422.9..423.5 kbp (669 bp) score=20
SL1157_0443 transcriptional regulator, Crp/Fnr family SL1157:442.1..442.8 kbp (621 bp) score=20
SL1157_0461 transcriptional regulator SoxR SL1157:456.4..456.8 kbp (363 bp) score=20
SL1157_0466 transcriptional regulator, IclR family SL1157:459.2..460 kbp (780 bp) score=20
SL1157_0560 putative transcriptional regulator SL1157:544.4..544.8 kbp (447 bp) score=20
SL1157_0595 Bkd operon transcriptional regulator SL1157:583.4..583.9 kbp (462 bp) score=20
SL1157_0613 autoinducer-binding transcriptional regulator LuxR SL1157:598.3..599 kbp (720 bp) score=20
SL1157_0643 transcriptional regulator, TetR family SL1157:626.7..627.2 kbp (579 bp) score=20
SL1157_0652 transcriptional regulator, TetR family domain protein SL1157:635.7..636.3 kbp (606 bp) score=20
SL1157_0671 transcriptional regulator, LysR family SL1157:650..650.9 kbp (948 bp) score=20
SL1157_0720 Bkd operon transcriptional regulator SL1157:691.1..691.6 kbp (459 bp) score=20
SL1157_0726 transcriptional regulator, LysR family SL1157:695.7..696.6 kbp (885 bp) score=20
SL1157_0768 transcriptional regulator, GntR family SL1157:738..738.7 kbp (702 bp) score=20
SL1157_0775 transcriptional regulatory protein TctD SL1157:746.1..746.7 kbp (669 bp) score=20
SL1157_0800 transcriptional regulator, TetR family SL1157:765..765.6 kbp (573 bp) score=20
SL1157_0814 transcriptional regulator, XRE family with cupin sensor SL1157:776.6..777.2 kbp (567 bp) score=20
SL1157_0826 transcriptional regulator, MarR family SL1157:789.5..790 kbp (441 bp) score=20
SL1157_0845 transcriptional regulator, AsnC family SL1157:803.5..804 kbp (429 bp) score=20
SL1157_0896 transcriptional regulator, XRE family SL1157:847.9..848.4 kbp (564 bp) score=20
SL1157_0901 transcriptional regulator, LacI family SL1157:856..857 kbp (999 bp) score=20
SL1157_0915 periplasmic binding protein/LacI transcriptional regulator SL1157:870.3..871.2 kbp (921 bp) score=20
SL1157_0944 transcriptional regulator, XRE family SL1157:903.3..903.9 kbp (555 bp) score=20
SL1157_0972 transcriptional regulator PetP SL1157:926.6..927.1 kbp (513 bp) score=20
SL1157_0980 negative transcriptional regulator SL1157:932.5..933.1 kbp (615 bp) score=20
SL1157_0988 transcriptional regulator, LuxR family SL1157:937.8..938.3 kbp (549 bp) score=20
SL1157_1016 transcriptional regulator, AraC family SL1157:972.9..973.9 kbp (948 bp) score=20
SL1157_1018 transcriptional regulator, LysR family SL1157:975.7..976.6 kbp (879 bp) score=20
SL1157_1155 transcriptional regulator, Fis family SL1157:1.117..1.118 Mbp (1.284 kbp) score=20
SL1157_1175 transcriptional regulator, LacI family SL1157:1.135..1.136 Mbp (1.041 kbp) score=20
SL1157_1193 transcriptional regulator, LysR family SL1157:1.157..1.158 Mbp (882 bp) score=20
SL1157_1266 putative transcriptional regulator OmpR SL1157:1.234..1.234 Mbp (738 bp) score=20
SL1157_1304 transcriptional regulator, LysR family SL1157:1.264..1.265 Mbp (888 bp) score=20
SL1157_1318 transcriptional regulator, LysR family SL1157:1.278..1.279 Mbp (861 bp) score=20
SL1157_1360 transcriptional regulator, GntR family SL1157:1.319..1.319 Mbp (711 bp) score=20
SL1157_1375 transcriptional regulator, ArsR family SL1157:1.334..1.334 Mbp (336 bp) score=20
SL1157_1392 transcriptional regulator, GntR family SL1157:1.346..1.347 Mbp (600 bp) score=20
SL1157_1401 transcriptional regulator, GntR family SL1157:1.357..1.357 Mbp (684 bp) score=20
SL1157_1449 two component transcriptional regulator, winged helix family SL1157:1.401..1.402 Mbp (717 bp) score=20
SL1157_1473 transcriptional regulator, AraC family SL1157:1.425..1.426 Mbp (972 bp) score=20
SL1157_1493 transcriptional regulator SL1157:1.447..1.448 Mbp (1.461 kbp) score=20
SL1157_1494 transcriptional regulator, ArsR family SL1157:1.448..1.449 Mbp (309 bp) score=20
SL1157_1507 transcriptional regulator, TetR family SL1157:1.457..1.457 Mbp (573 bp) score=20
SL1157_1533 transcriptional regulator, LysR family SL1157:1.478..1.479 Mbp (753 bp) score=20
SL1157_1692 transcriptional regulator, Fur family SL1157:1.606..1.607 Mbp (483 bp) score=20
SL1157_1764 periplasmic binding protein/LacI transcriptional regulator SL1157:1.686..1.687 Mbp (1.038 kbp) score=20
SL1157_1774 transcriptional regulator, GntR family SL1157:1.693..1.694 Mbp (648 bp) score=20
SL1157_1800 transcriptional regulator, LysR family SL1157:1.718..1.719 Mbp (1.059 kbp) score=20
SL1157_1801 transcriptional regulator, LacI family SL1157:1.719..1.72 Mbp (1.02 kbp) score=20
SL1157_1822 transcriptional regulator, MarR family SL1157:1.739..1.739 Mbp (453 bp) score=20
SL1157_1842 transcriptional regulator, LysR family SL1157:1.752..1.753 Mbp (879 bp) score=20
SL1157_1844 transcriptional regulator, ArsR family SL1157:1.755..1.755 Mbp (375 bp) score=20
SL1157_1903 transcriptional regulatory protein ChvI SL1157:1.798..1.799 Mbp (705 bp) score=20
SL1157_1952 transcriptional regulator, Crp/Fnr family SL1157:1.85..1.851 Mbp (666 bp) score=20
SL1157_2017 transcriptional regulator, MarR family SL1157:1.913..1.913 Mbp (468 bp) score=20
SL1157_2052 transcriptional regulator MetR SL1157:1.948..1.949 Mbp (906 bp) score=20
SL1157_2097 transcriptional regulator, LysR family SL1157:1.991..1.992 Mbp (885 bp) score=20
SL1157_2099 transcriptional regulator, XRE family SL1157:1.993..1.993 Mbp (372 bp) score=20
SL1157_2115 transcriptional regulator SoxR SL1157:2.009..2.01 Mbp (336 bp) score=20
SL1157_2125 transcriptional regulator, LuxR family SL1157:2.017..2.017 Mbp (537 bp) score=20
SL1157_2126 transcriptional regulator, XRE family SL1157:2.017..2.019 Mbp (1.296 kbp) score=20
SL1157_2127 transcriptional regulatory protein ResD SL1157:2.019..2.019 Mbp (381 bp) score=20
SL1157_2181 transcriptional regulator, MerR family SL1157:2.072..2.072 Mbp (402 bp) score=20
SL1157_2182 transcriptional regulator, MerR family SL1157:2.072..2.073 Mbp (369 bp) score=20
SL1157_2213 transcriptional regulator, DeoR family SL1157:2.106..2.107 Mbp (816 bp) score=20
SL1157_2243 transcriptional regulator, LysR family SL1157:2.131..2.132 Mbp (876 bp) score=20
SL1157_2279 putative transcriptional regulator SL1157:2.16..2.161 Mbp (429 bp) score=20
SL1157_2286 transcriptional regulator, XRE family SL1157:2.169..2.17 Mbp (390 bp) score=20
SL1157_2289 transcriptional regulator, MarR family SL1157:2.17..2.171 Mbp (498 bp) score=20
SL1157_2319 transcriptional regulator, MerR family SL1157:2.195..2.195 Mbp (390 bp) score=20
SL1157_2349 transcriptional regulator, Crp/Fnr family SL1157:2.22..2.221 Mbp (669 bp) score=20
SL1157_2383 transcriptional regulator, AsnC family SL1157:2.256..2.257 Mbp (456 bp) score=20
SL1157_2384 transcriptional regulator, AsnC family SL1157:2.257..2.257 Mbp (459 bp) score=20
SL1157_2385 transcriptional regulator, GntR family SL1157:2.257..2.258 Mbp (780 bp) score=20
SL1157_2391 transcriptional regulator, GntR family SL1157:2.262..2.262 Mbp (648 bp) score=20
SL1157_2403 transcriptional regulator, ArsR family SL1157:2.273..2.274 Mbp (831 bp) score=20
SL1157_2512 transcriptional regulator, TraR/DksA family SL1157:2.378..2.379 Mbp (339 bp) score=20
SL1157_2552 transcriptional regulator, XRE family SL1157:2.418..2.419 Mbp (732 bp) score=20
SL1157_2592 transcriptional regulator, MerR family SL1157:2.455..2.455 Mbp (585 bp) score=20
SL1157_2605 transcriptional regulator, GntR family SL1157:2.464..2.465 Mbp (264 bp) score=20
SL1157_2638 transcriptional regulator, AraC family SL1157:2.495..2.496 Mbp (987 bp) score=20
SL1157_2643 transcriptional regulator, XRE family SL1157:2.5..2.5 Mbp (867 bp) score=20
SL1157_2707 transcriptional regulator, XRE family SL1157:2.562..2.562 Mbp (624 bp) score=20
SL1157_2807 transcriptional regulator, GntR family SL1157:2.651..2.653 Mbp (1.404 kbp) score=20
SL1157_2844 autoinducer-binding transcriptional regulator, LuxR family SL1157:2.68..2.68 Mbp (756 bp) score=20
SL1157_2849 transcriptional regulator, IclR family SL1157:2.684..2.685 Mbp (795 bp) score=20
SL1157_2855 transcriptional regulator, LysR family SL1157:2.689..2.69 Mbp (912 bp) score=20
SL1157_2863 transcriptional regulator, AraC family SL1157:2.697..2.698 Mbp (1.005 kbp) score=20
SL1157_2914 transcriptional regulatory protein DegU SL1157:2.743..2.744 Mbp (642 bp) score=20
SL1157_2918 transcriptional regulator, LysR family SL1157:2.746..2.747 Mbp (849 bp) score=20
SL1157_2950 cell cycle transcriptional regulator CtrA SL1157:2.782..2.783 Mbp (717 bp) score=20
SL1157_2971 transcriptional regulator, GntR family SL1157:2.8..2.801 Mbp (732 bp) score=20
SL1157_2990 C4-dicarboxylate transport transcriptional regulatory protein DctD SL1157:2.818..2.819 Mbp (1.335 kbp) score=20
SL1157_3007 transcriptional regulator, LysR family SL1157:2.836..2.837 Mbp (909 bp) score=20
SL1157_3023 transcriptional regulator, LysR family SL1157:2.851..2.852 Mbp (903 bp) score=20
SL1157_3056 C4-dicarboxylate transport transcriptional regulatory protein DctD SL1157:2.881..2.882 Mbp (1.23 kbp) score=20
SL1157_3069 transcriptional regulator, RpiR family SL1157:2.893..2.894 Mbp (990 bp) score=20
SL1157_3103 transcriptional regulator, TetR family SL1157:2.925..2.925 Mbp (615 bp) score=20
SL1157_3167 transcriptional regulator, AsnC family SL1157:2.992..2.993 Mbp (429 bp) score=20
SL1157_3210 transcriptional regulator, TetR family SL1157:3.033..3.033 Mbp (609 bp) score=20
SL1157_3220 transcriptional regulator, AsnC family SL1157:3.044..3.045 Mbp (504 bp) score=20
SL1157_3226 transcriptional regulator, CarD family SL1157:3.051..3.051 Mbp (510 bp) score=20
nrdR transcriptional regulator NrdR SL1157:3.083..3.083 Mbp (471 bp) score=20
SL1157_3279 transcriptional regulator, TetR family SL1157:3.102..3.103 Mbp (618 bp) score=20
SL1157_3380 transcriptional regulator, TetR family SL1157:3.195..3.196 Mbp (624 bp) score=20
cueR Cu(I)-responsive transcriptional regulator SL1157:3.244..3.245 Mbp (387 bp) score=20
phoB phosphate regulon transcriptional regulatory protein PhoB SL1157:3.257..3.258 Mbp (687 bp) score=20
SL1157_A0049 transcriptional regulator LacI-family SL1157:3.279..3.28 Mbp (1.011 kbp) score=20
SL1157_A0050 transcriptional regulator, HxlR family SL1157:3.28..3.28 Mbp (369 bp) score=20
SL1157_A0063 transcriptional regulator, TetR family SL1157:3.29..3.291 Mbp (618 bp) score=20
SL1157_A0105 transcriptional regulator, RpiR family SL1157:3.332..3.333 Mbp (876 bp) score=20
SL1157_A0145 transcriptional regulator, GntR family SL1157:3.375..3.376 Mbp (690 bp) score=20
SL1157_A0152 transcriptional regulator, IclR family SL1157:3.382..3.383 Mbp (795 bp) score=20
SL1157_A0173 transcriptional regulator, LacI family SL1157:3.406..3.407 Mbp (1.032 kbp) score=20
SL1157_A0210 transcriptional regulator, LacI family SL1157:3.445..3.446 Mbp (996 bp) score=20
SL1157_A0220 transcriptional regulator domain protein SL1157:3.457..3.459 Mbp (1.359 kbp) score=20
SL1157_A0247 transcriptional regulator SL1157:3.492..3.492 Mbp (522 bp) score=20
SL1157_A0255 transcriptional regulator, LacI family SL1157:3.499..3.5 Mbp (1.014 kbp) score=20
SL1157_A0267 transcriptional regulator, LysR family SL1157:3.514..3.515 Mbp (930 bp) score=20
betI transcriptional repressor BetI SL1157:78.23..78.83 kbp (600 bp) score=10
SL1157_0128 GcrA cell cycle regulator SL1157:114.3..114.9 kbp (579 bp) score=10
SL1157_0182 response regulator receiver protein SL1157:171.4..172.7 kbp (1.236 kbp) score=10
SL1157_0194 response regulator receiver protein SL1157:183.3..184.1 kbp (852 bp) score=10
SL1157_0423 response regulator receiver domain protein SL1157:419.7..420.3 kbp (567 bp) score=10
SL1157_0526 DNA-binding response regulator SL1157:517.3..518 kbp (678 bp) score=10
SL1157_0527 two-component hybrid sensor and regulator SL1157:518..519.3 kbp (1.374 kbp) score=10
soxR redox-sensitive transcriptional activator SoxR SL1157:642..642.4 kbp (456 bp) score=10
SL1157_0777 regulatory protein, LacI family SL1157:748.3..748.6 kbp (390 bp) score=10
SL1157_0891 nitrogen regulatory protein P-II SL1157:843.7..844 kbp (339 bp) score=10
ompR DNA-binding response regulator OmpR SL1157:925.9..926.6 kbp (702 bp) score=10
SL1157_1044 DNA-binding response regulator SL1157:1.008..1.009 Mbp (672 bp) score=10
SL1157_1059 photosynthetic apparatus regulatory protein RegA SL1157:1.022..1.023 Mbp (555 bp) score=10
SL1157_1108 response regulator SL1157:1.07..1.072 Mbp (1.266 kbp) score=10
SL1157_1178 response regulator receiver SL1157:1.138..1.139 Mbp (585 bp) score=10
SL1157_1299 ADA regulatory protein SL1157:1.26..1.26 Mbp (852 bp) score=10
SL1157_1340 transcriptional activator ChrR SL1157:1.3..1.301 Mbp (660 bp) score=10
SL1157_1413 flagellar biosynthesis regulatory protein FlaF SL1157:1.368..1.368 Mbp (375 bp) score=10
SL1157_1417 response regulator receiver protein SL1157:1.371..1.372 Mbp (657 bp) score=10
SL1157_1524 transcriptional activator protein FnrL SL1157:1.472..1.473 Mbp (756 bp) score=10
SL1157_1742 ATP phosphoribosyltransferase regulatory subunit SL1157:1.664..1.665 Mbp (1.089 kbp) score=10
SL1157_1786 proline dehydrogenase transcriptional activator SL1157:1.704..1.704 Mbp (474 bp) score=10
SL1157_1865 response regulator SL1157:1.771..1.771 Mbp (306 bp) score=10
SL1157_1957 glutamate uptake regulatory protein SL1157:1.856..1.856 Mbp (462 bp) score=10
SL1157_2003 leucine-responsive regulatory protein SL1157:1.902..1.902 Mbp (501 bp) score=10
SL1157_2026 response regulator SL1157:1.927..1.928 Mbp (720 bp) score=10
SL1157_2057 proline dehydrogenase transcriptional activator SL1157:1.954..1.955 Mbp (489 bp) score=10
SL1157_2092 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD SL1157:1.987..1.988 Mbp (1.257 kbp) score=10
SL1157_2248 response regulator receiver and sarp domain protein SL1157:2.135..2.136 Mbp (816 bp) score=10
SL1157_2397 mercuric resistance operon regulatory protein SL1157:2.27..2.27 Mbp (447 bp) score=10
SL1157_2411 negative regulator of genetic competence ClpC/mecB SL1157:2.281..2.283 Mbp (2.823 kbp) score=10
SL1157_2472 nitrogen regulatory protein P-II SL1157:2.343..2.343 Mbp (339 bp) score=10
SL1157_2557 DNA-binding response regulator, LuxR family SL1157:2.422..2.423 Mbp (645 bp) score=10
SL1157_2684 nitrogen assimilation regulatory protein SL1157:2.536..2.537 Mbp (1.368 kbp) score=10
phoU_1 phosphate transport system regulatory protein PhoU SL1157:2.69..2.691 Mbp (702 bp) score=10
SL1157_2907 sensory box sensor histidine kianse/response regulator SL1157:2.733..2.736 Mbp (2.292 kbp) score=10
SL1157_3059 glutamate uptake regulatory protein SL1157:2.885..2.885 Mbp (480 bp) score=10
SL1157_3143 DNA-binding response regulator SL1157:2.964..2.965 Mbp (681 bp) score=10
SL1157_3294 transcriptional repressor, CopY family SL1157:3.114..3.115 Mbp (396 bp) score=10
SL1157_3318 response regulator receiver modulated diguanylate cyclase SL1157:3.134..3.135 Mbp (1.404 kbp) score=10
phoU_2 phosphate transport system regulatory protein PhoU SL1157:3.256..3.257 Mbp (729 bp) score=10
SL1157_A0031 positive regulator AgmR SL1157:3.261..3.261 Mbp (615 bp) score=10
SL1157_A0037 sensory box histidine kinase/response regulator SL1157:3.264..3.267 Mbp (2.538 kbp) score=10
SL1157_A0109 DNA-binding response regulator SL1157:3.339..3.339 Mbp (702 bp) score=10
SL1157_A0110 sensory box histidine kinase/response regulator SL1157:3.339..3.341 Mbp (1.896 kbp) score=10
SL1157_A0203 regulatory protein NosR SL1157:3.437..3.439 Mbp (2.175 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70