Roseobase: Loktanella vestfoldensis SKA53

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: SKA53:500000..600000, SKA53_00080, modB, ZP_01004559, SKA53_t15418, SKA53_r15422, transcriptional regulator, MAHVPDTPSSVLGVTPFMMVRRIVTVLTVGLVIGAVTAIAAIAFVEAVLWLNDLLLVSSYAKVQSGL.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 172 regions match your request.
Matches on SKA53
overview_SKA53
SKA53_00140 putative transcriptional regulator, GntR family protein COG1802 Transcriptional regulators SKA53:27.91..28.59 kbp (687 bp) score=40
SKA53_00240 transcriptional regulator, XRE family COG2944 Predicted transcriptional regulator SKA53:48.34..48.67 kbp (324 bp) score=40
SKA53_00604 transcriptional regulator COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs SKA53:115.9..117.4 kbp (1.467 kbp) score=40
SKA53_00939 transcriptional regulator, TetR family COG1309 Transcriptional regulator SKA53:188.2..188.8 kbp (630 bp) score=40
SKA53_01541 Transcriptional regulator, LysR family COG0583 Transcriptional regulator SKA53:287.5..288.4 kbp (870 bp) score=40
SKA53_01616 transcriptional regulator, BetI COG1309 Transcriptional regulator SKA53:302.6..303.1 kbp (570 bp) score=40
SKA53_01841 transcriptional regulator, XRE family COG1396 Predicted transcriptional regulators SKA53:348.2..348.6 kbp (393 bp) score=40
SKA53_01851 transcriptional regulator, MarR family COG1846 Transcriptional regulators SKA53:348.9..349.4 kbp (522 bp) score=40
SKA53_01881 transcriptional regulator, TetR family COG1309 Transcriptional regulator SKA53:354.8..355.3 kbp (588 bp) score=40
SKA53_02071 putative CarD-like transcriptional regulator COG1329 Transcriptional regulators, similar to M. xanthus CarD SKA53:393.5..394.2 kbp (678 bp) score=40
SKA53_02161 transcriptional regulator, putative COG1396 Predicted transcriptional regulators SKA53:410.8..412.2 kbp (1.371 kbp) score=40
SKA53_02211 transcriptional regulator SoxR COG0640 Predicted transcriptional regulators SKA53:419..419.3 kbp (318 bp) score=40
SKA53_02686 transcriptional regulator, AsnC family COG1522 Transcriptional regulators SKA53:516..516.5 kbp (519 bp) score=40
SKA53_02856 Transcriptional regulator, LysR family COG0583 Transcriptional regulator SKA53:558.2..559.1 kbp (903 bp) score=40
SKA53_02921 Transcriptional regulator, LysR family COG0583 Transcriptional regulator SKA53:569.1..570 kbp (906 bp) score=40
SKA53_03634 LysR-family transcriptional regulator COG0583 Transcriptional regulator SKA53:714.7..715.6 kbp (936 bp) score=40
SKA53_04158 transcriptional regulator, GntR family COG2188 Transcriptional regulators SKA53:818..818.9 kbp (816 bp) score=40
SKA53_04438 transcriptional regulator, GntR family COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs SKA53:891.3..892.7 kbp (1.425 kbp) score=40
SKA53_04503 transcriptional regulator, TetR family COG1309 Transcriptional regulator SKA53:903.8..904.4 kbp (618 bp) score=40
SKA53_04598 transcriptional regulator, AsnC family COG1522 Transcriptional regulators SKA53:923.8..924.2 kbp (420 bp) score=40
SKA53_04798 transcriptional regulator, AraC family COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain SKA53:962..963 kbp (1.002 kbp) score=40
SKA53_06497 transcriptional regulator, ArsR family COG0640 Predicted transcriptional regulators SKA53:1.274..1.274 Mbp (297 bp) score=40
SKA53_06742 transcriptional regulator, GntR family COG2188 Transcriptional regulators SKA53:1.318..1.319 Mbp (717 bp) score=40
SKA53_06777 transcriptional regulator, CopG family COG0864 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain SKA53:1.325..1.325 Mbp (465 bp) score=40
SKA53_06792 transcriptional regulator/arsenate reductase COG0640 Predicted transcriptional regulators SKA53:1.327..1.328 Mbp (828 bp) score=40
SKA53_07017 transcriptional regulator, GntR family COG1802 Transcriptional regulators SKA53:1.374..1.374 Mbp (654 bp) score=40
SKA53_07037 transcriptional regulator, AsnC family COG1522 Transcriptional regulators SKA53:1.378..1.378 Mbp (453 bp) score=40
SKA53_07042 transcriptional regulator, AsnC family COG1522 Transcriptional regulators SKA53:1.378..1.378 Mbp (456 bp) score=40
SKA53_07331 transcriptional regulator, AsnC family COG1522 Transcriptional regulators SKA53:1.44..1.441 Mbp (462 bp) score=40
SKA53_07941 Transcriptional regulator, LysR family COG0583 Transcriptional regulator SKA53:1.555..1.556 Mbp (813 bp) score=40
SKA53_08021 putative transcriptional regulator protein COG1522 Transcriptional regulators SKA53:1.57..1.571 Mbp (357 bp) score=40
SKA53_08051 transcriptional regulator lysR family COG0583 Transcriptional regulator SKA53:1.576..1.577 Mbp (882 bp) score=40
SKA53_08821 transcriptional regulator COG1609 Transcriptional regulators SKA53:1.729..1.73 Mbp (999 bp) score=40
SKA53_08904 transcriptional regulatory protein COG0640 Predicted transcriptional regulators SKA53:1.747..1.747 Mbp (297 bp) score=40
SKA53_09204 Cu(I)-responsive transcriptional regulator COG0789 Predicted transcriptional regulators SKA53:1.813..1.814 Mbp (399 bp) score=40
SKA53_09314 transcriptional regulator, MerR family COG0789 Predicted transcriptional regulators SKA53:1.834..1.834 Mbp (369 bp) score=40
SKA53_09319 transcriptional regulator, MerR family COG0789 Predicted transcriptional regulators SKA53:1.834..1.835 Mbp (402 bp) score=40
SKA53_09689 transcriptional regulators, LysR family COG0583 Transcriptional regulator SKA53:1.913..1.914 Mbp (888 bp) score=40
SKA53_09699 transcriptional regulator, MarR family COG1846 Transcriptional regulators SKA53:1.915..1.915 Mbp (447 bp) score=40
SKA53_09879 transcriptional regulator, IclR family COG1414 Transcriptional regulator SKA53:1.957..1.958 Mbp (819 bp) score=40
SKA53_10139 transcriptional regulator, AsnC family COG1522 Transcriptional regulators SKA53:2.009..2.01 Mbp (459 bp) score=40
SKA53_10334 transcriptional regulator, RpiR family COG1737 Transcriptional regulators SKA53:2.052..2.053 Mbp (870 bp) score=40
SKA53_10679 transcriptional regulator, TetR family COG1309 Transcriptional regulator SKA53:2.134..2.135 Mbp (603 bp) score=40
SKA53_10779 transcriptional regulator, MarR family COG1846 Transcriptional regulators SKA53:2.158..2.158 Mbp (507 bp) score=40
SKA53_10984 transcriptional regulatory protein COG0583 Transcriptional regulator SKA53:2.2..2.201 Mbp (897 bp) score=40
SKA53_11074 transcriptional regulator COG1609 Transcriptional regulators SKA53:2.214..2.214 Mbp (477 bp) score=40
SKA53_11093 putative transcriptional regulator, LacI family protein COG1609 Transcriptional regulators SKA53:2.214..2.215 Mbp (227 bp) score=40
SKA53_11718 transcriptional regulator, putative COG1846 Transcriptional regulators SKA53:2.339..2.339 Mbp (444 bp) score=40
SKA53_12393 transcriptional regulator, LacI family COG1609 Transcriptional regulators SKA53:2.479..2.48 Mbp (1.032 kbp) score=40
SKA53_12723 putative transcriptional regulator COG1309 Transcriptional regulator SKA53:2.544..2.544 Mbp (693 bp) score=40
SKA53_12848 transcriptional regulator COG1309 Transcriptional regulator SKA53:2.571..2.572 Mbp (621 bp) score=40
SKA53_13826 Transcriptional regulator, LysR family COG0583 Transcriptional regulator SKA53:2.752..2.753 Mbp (906 bp) score=40
SKA53_14156 transcriptional regulator, TetR family COG1309 Transcriptional regulator SKA53:2.813..2.814 Mbp (627 bp) score=40
SKA53_14216 transcriptional regulator, AsnC family COG1522 Transcriptional regulators SKA53:2.822..2.822 Mbp (468 bp) score=40
SKA53_14471 transcriptional regulatory protein COG0583 Transcriptional regulator SKA53:2.877..2.877 Mbp (918 bp) score=40
SKA53_14496 transcriptional regulator, GntR family COG1802 Transcriptional regulators SKA53:2.881..2.882 Mbp (720 bp) score=40
SKA53_15016 Transcriptional regulator, LysR family COG0583 Transcriptional regulator SKA53:2.979..2.979 Mbp (873 bp) score=40
SKA53_15026 transcriptional regulator, ArsR family COG0640 Predicted transcriptional regulators SKA53:2.98..2.981 Mbp (396 bp) score=40
SKA53_15331 transcriptional regulator MetR COG0583 Transcriptional regulator SKA53:3.042..3.043 Mbp (921 bp) score=40
SKA53_00834 pca operon transcriptional activator PcaQ COG0583 Transcriptional regulator SKA53:164.3..165.2 kbp (912 bp) score=30
SKA53_00889 bacterial regulatory protein, MarR COG1846 Transcriptional regulators SKA53:176.6..177.1 kbp (483 bp) score=30
SKA53_00924 transcription regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain SKA53:184.5..185.5 kbp (990 bp) score=30
SKA53_03274 putative transcription regulator protein COG1609 Transcriptional regulators SKA53:640.9..642 kbp (1.104 kbp) score=30
SKA53_03454 C4-dicarboxylate transport transcriptional regulatory protein DctD COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains SKA53:676.1..677.4 kbp (1.332 kbp) score=30
SKA53_03709 pca operon transcriptional activator PcaQ COG0583 Transcriptional regulator SKA53:727.3..728.2 kbp (927 bp) score=30
SKA53_03869 transcriptional regulator, Crp-Fnr family COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases SKA53:760..760.8 kbp (762 bp) score=30
SKA53_04188 probable transcription regulator protein COG0583 Transcriptional regulator SKA53:823.7..824.6 kbp (900 bp) score=30
SKA53_04868 nitrogen metabolism transcriptional regulator, NtrC COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains SKA53:980.7..982.1 kbp (1.377 kbp) score=30
SKA53_05373 trancriptional regulator, MerR family COG0789 Predicted transcriptional regulators SKA53:1.072..1.072 Mbp (648 bp) score=30
SKA53_06057 transcriptional activator, Baf family COG1521 putative transcriptional regulator, homolog of Bvg accessory factor SKA53:1.202..1.203 Mbp (774 bp) score=30
SKA53_08101 regulatory protein GntR, HTH:GntR, C-terminal COG1802 Transcriptional regulators SKA53:1.586..1.586 Mbp (690 bp) score=30
SKA53_08721 Proline dehydrogenase transcriptional activator COG1522 Transcriptional regulators SKA53:1.71..1.711 Mbp (513 bp) score=30
SKA53_09719 phosphate regulon transcriptional regulatory protein PhoB COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:1.921..1.922 Mbp (690 bp) score=30
SKA53_09814 two component transcriptional regulator, LuxR family COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain SKA53:1.943..1.943 Mbp (615 bp) score=30
SKA53_11388 sigma54 specific transcriptional regulator, fis family COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains SKA53:2.266..2.266 Mbp (894 bp) score=30
SKA53_12763 Two component Transcriptional regulator, Winged helix family COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:2.553..2.554 Mbp (681 bp) score=30
SKA53_13143 two-component transcriptional regulator, winged helix family COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:2.629..2.629 Mbp (648 bp) score=30
SKA53_13641 putative transcription regulator protein COG0583 Transcriptional regulator SKA53:2.718..2.718 Mbp (903 bp) score=30
SKA53_15351 Proline dehydrogenase transcriptional activator COG1522 Transcriptional regulators SKA53:3.048..3.049 Mbp (492 bp) score=30
SKA53_00170 COG2188 Transcriptional regulators SKA53:33.23..33.6 kbp (366 bp) score=20
SKA53_00255 COG1396 Predicted transcriptional regulators SKA53:50.34..50.64 kbp (294 bp) score=20
SKA53_00430 COG1940 Transcriptional regulator/sugar kinase SKA53:81.5..82.41 kbp (909 bp) score=20
SKA53_00559 COG1414 Transcriptional regulator SKA53:107.1..107.9 kbp (795 bp) score=20
SKA53_00674 COG3311 Predicted transcriptional regulator SKA53:132.6..132.8 kbp (195 bp) score=20
SKA53_00719 COG2186 Transcriptional regulators SKA53:142.1..142.8 kbp (693 bp) score=20
SKA53_00794 transcriptional regulator, AraC family SKA53:157.6..158.6 kbp (912 bp) score=20
SKA53_01126 transcriptional regulator, Fur family SKA53:220.4..220.8 kbp (417 bp) score=20
SKA53_01226 transcriptional regulator, LuxR family SKA53:237.7..238.1 kbp (417 bp) score=20
SKA53_01351 COG1396 Predicted transcriptional regulators SKA53:259.9..260.8 kbp (900 bp) score=20
SKA53_01551 COG1396 Predicted transcriptional regulators SKA53:289.6..290 kbp (372 bp) score=20
SKA53_01646 COG1396 Predicted transcriptional regulators SKA53:309.1..310.5 kbp (1.401 kbp) score=20
SKA53_01941 COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains SKA53:369.9..370.3 kbp (471 bp) score=20
SKA53_02166 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:412.2..412.6 kbp (369 bp) score=20
SKA53_02256 COG3311 Predicted transcriptional regulator SKA53:427.4..427.7 kbp (210 bp) score=20
SKA53_02271 COG1609 Transcriptional regulators SKA53:429.6..430.7 kbp (1.041 kbp) score=20
SKA53_02331 COG1609 Transcriptional regulators SKA53:443..444.1 kbp (1.113 kbp) score=20
SKA53_02476 COG1522 Transcriptional regulators SKA53:475.1..475.6 kbp (462 bp) score=20
SKA53_02481 COG1940 Transcriptional regulator/sugar kinase SKA53:475.7..476.9 kbp (1.23 kbp) score=20
SKA53_02526 COG2378 Predicted transcriptional regulator SKA53:484.5..485.2 kbp (699 bp) score=20
SKA53_03714 possible response regulator COG3947 Response regulator containing CheY-like receiver and SARP domains SKA53:728.2..729.7 kbp (1.473 kbp) score=20
SKA53_03799 transcriptional regulator, AraC family SKA53:748.8..749.8 kbp (993 bp) score=20
SKA53_03829 COG1475 Predicted transcriptional regulators SKA53:753.5..753.8 kbp (390 bp) score=20
SKA53_04293 COG2378 Predicted transcriptional regulator SKA53:865.7..866.6 kbp (879 bp) score=20
SKA53_04543 DNA-binding response regulator CtrA COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:910.3..911 kbp (714 bp) score=20
SKA53_04673 COG1396 Predicted transcriptional regulators SKA53:938.7..939.3 kbp (624 bp) score=20
SKA53_04758 phosphate transport system regulatory protein PhoU COG0704 Phosphate uptake regulator SKA53:955.9..956.6 kbp (708 bp) score=20
SKA53_04858 nitrogen assimilation regulatory protein NtrX COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains SKA53:976.9..978.3 kbp (1.404 kbp) score=20
SKA53_04968 COG1396 Predicted transcriptional regulators SKA53:998.9..999.1 kbp (276 bp) score=20
SKA53_05138 COG3355 Predicted transcriptional regulator SKA53:1.03..1.03 Mbp (303 bp) score=20
SKA53_05183 COG1959 Predicted transcriptional regulator SKA53:1.038..1.039 Mbp (462 bp) score=20
SKA53_05393 COG1386 Predicted transcriptional regulator containing the HTH domain SKA53:1.074..1.075 Mbp (642 bp) score=20
SKA53_05805 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII SKA53:1.148..1.149 Mbp (339 bp) score=20
SKA53_05835 transcriptional regulator, LuxR family SKA53:1.154..1.154 Mbp (609 bp) score=20
SKA53_06442 COG0583 Transcriptional regulator SKA53:1.267..1.267 Mbp (354 bp) score=20
SKA53_06487 COG1733 Predicted transcriptional regulators SKA53:1.273..1.273 Mbp (363 bp) score=20
SKA53_06597 COG1309 Transcriptional regulator SKA53:1.295..1.296 Mbp (699 bp) score=20
SKA53_06882 COG2188 Transcriptional regulators SKA53:1.343..1.344 Mbp (708 bp) score=20
SKA53_06962 COG1940 Transcriptional regulator/sugar kinase SKA53:1.36..1.362 Mbp (1.266 kbp) score=20
SKA53_07816 COG1396 Predicted transcriptional regulators SKA53:1.529..1.53 Mbp (447 bp) score=20
SKA53_07851 two-component response regulator COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain SKA53:1.535..1.535 Mbp (393 bp) score=20
SKA53_07871 DNA-binding response regulator QseB, putative COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:1.541..1.541 Mbp (678 bp) score=20
SKA53_08026 transcriptional regulator, LuxR family SKA53:1.571..1.572 Mbp (468 bp) score=20
SKA53_08166 COG1349 Transcriptional regulators of sugar metabolism SKA53:1.6..1.601 Mbp (840 bp) score=20
SKA53_08756 transcriptional activator protein FnrL COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases SKA53:1.715..1.716 Mbp (726 bp) score=20
SKA53_08766 COG1609 Transcriptional regulators SKA53:1.717..1.718 Mbp (1.023 kbp) score=20
SKA53_09584 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:1.885..1.886 Mbp (717 bp) score=20
SKA53_09724 phosphate transport system regulatory protein COG0704 Phosphate uptake regulator SKA53:1.922..1.923 Mbp (717 bp) score=20
SKA53_09924 transcriptional regulator SKA53:1.966..1.967 Mbp (834 bp) score=20
SKA53_10039 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:1.988..1.988 Mbp (390 bp) score=20
SKA53_10179 COG1396 Predicted transcriptional regulators SKA53:2.02..2.021 Mbp (570 bp) score=20
SKA53_10269 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:2.038..2.038 Mbp (702 bp) score=20
SKA53_10774 DNA-binding response regulator PetR COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:2.157..2.158 Mbp (702 bp) score=20
SKA53_10949 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain SKA53:2.192..2.193 Mbp (996 bp) score=20
SKA53_10999 putative transcriptional regulator protein SKA53:2.203..2.203 Mbp (588 bp) score=20
SKA53_11838 COG1420 Transcriptional regulator of heat shock gene SKA53:2.363..2.364 Mbp (1.101 kbp) score=20
SKA53_11858 COG1475 Predicted transcriptional regulators SKA53:2.366..2.367 Mbp (888 bp) score=20
SKA53_12003 photosynthetic apparatus regulatory protein RegA COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain SKA53:2.397..2.398 Mbp (561 bp) score=20
SKA53_12013 Transcriptional regulator, PpsR SKA53:2.398..2.4 Mbp (1.428 kbp) score=20
SKA53_12918 two-component response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:2.583..2.583 Mbp (651 bp) score=20
SKA53_13946 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII SKA53:2.778..2.778 Mbp (339 bp) score=20
SKA53_14101 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII SKA53:2.805..2.805 Mbp (309 bp) score=20
SKA53_14326 COG1678 putative transcriptional regulator SKA53:2.845..2.845 Mbp (570 bp) score=20
SKA53_15056 COG2186 Transcriptional regulators SKA53:2.984..2.984 Mbp (768 bp) score=20
SKA53_01391 COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain SKA53:264.7..266.1 kbp (1.329 kbp) score=10
SKA53_01416 Zinc-uptake regulator, Zur SKA53:270..270.5 kbp (489 bp) score=10
SKA53_01506 COG3023 Negative regulator of beta-lactamase expression SKA53:284.1..284.7 kbp (618 bp) score=10
SKA53_02236 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:422.2..423.1 kbp (882 bp) score=10
SKA53_02996 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) SKA53:586.5..587.2 kbp (684 bp) score=10
SKA53_03101 Ferric-uptake regulator SKA53:608.9..609.4 kbp (420 bp) score=10
SKA53_03259 sensory box sensor histidine kianse/response regulator SKA53:636.3..638.6 kbp (2.247 kbp) score=10
SKA53_03464 COG0425 Predicted redox protein, regulator of disulfide bond formation SKA53:680.6..680.8 kbp (228 bp) score=10
SKA53_03529 regulatory protein SenC SKA53:691..691.6 kbp (606 bp) score=10
SKA53_04953 transcriptional activator RfaH SKA53:996.6..997.1 kbp (516 bp) score=10
SKA53_05568 COG0440 Acetolactate synthase, small (regulatory) subunit SKA53:1.11..1.111 Mbp (564 bp) score=10
SKA53_05840 possible transcriptional activator SKA53:1.154..1.155 Mbp (381 bp) score=10
SKA53_06927 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases SKA53:1.352..1.353 Mbp (672 bp) score=10
SKA53_07356 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:1.449..1.45 Mbp (627 bp) score=10
SKA53_07371 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) SKA53:1.451..1.452 Mbp (471 bp) score=10
SKA53_08011 COG1764 Predicted redox protein, regulator of disulfide bond formation SKA53:1.569..1.569 Mbp (402 bp) score=10
SKA53_08156 COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain SKA53:1.598..1.599 Mbp (1.047 kbp) score=10
SKA53_08456 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) SKA53:1.659..1.66 Mbp (840 bp) score=10
SKA53_08884 ATP phosphoribosyltransferase regulatory subunit SKA53:1.74..1.741 Mbp (1.08 kbp) score=10
SKA53_09224 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) SKA53:1.818..1.818 Mbp (285 bp) score=10
SKA53_09229 chemotaxis regulator protein SKA53:1.818..1.818 Mbp (372 bp) score=10
SKA53_09254 Chemotaxis response regulator SKA53:1.822..1.822 Mbp (387 bp) score=10
SKA53_09264 COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain SKA53:1.823..1.824 Mbp (987 bp) score=10
SKA53_11403 flagellar synthesis regulator SKA53:2.268..2.268 Mbp (723 bp) score=10
SKA53_11568 PTS IIA-like nitrogen-regulatory protein PtsN SKA53:2.304..2.305 Mbp (465 bp) score=10
SKA53_12018 regulatory protein, PpaA SKA53:2.4..2.4 Mbp (660 bp) score=10
SKA53_12398 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain SKA53:2.48..2.48 Mbp (651 bp) score=10
SKA53_14411 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) SKA53:2.86..2.863 Mbp (2.094 kbp) score=10
SKA53_15066 ADA regulatory protein SKA53:2.985..2.986 Mbp (876 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70