Roseobase: Ruegeria sp. TrichCH4B

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: SCH4B:300000..400000, SCH4B_0014, aroA, ZP_05739733, transcriptional regulator, VVNAVVYVIDPHHVQYCHLELEEQARIIAHAVGGRGPNSEYLFNTAGHLDEIGLSDPDLSWLT.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 287 regions match your request.
Matches on SCH4B
overview_SCH4B
SCH4B_0021 Uxu operon transcriptional regulator SCH4B:18.45..19.18 kbp (732 bp) score=20
SCH4B_0026 transcriptional regulator, AraC family SCH4B:25.03..25.68 kbp (648 bp) score=20
SCH4B_0044 transcriptional regulator, LysR family SCH4B:36.02..36.98 kbp (954 bp) score=20
SCH4B_0053 transcriptional regulator, ArsR family SCH4B:39.7..40.07 kbp (375 bp) score=20
SCH4B_0069 transcriptional regulator, HxlR family SCH4B:47.22..47.87 kbp (657 bp) score=20
SCH4B_0070 transcriptional regulator, LysR family SCH4B:48.16..48.4 kbp (240 bp) score=20
SCH4B_0086 periplasmic binding protein/LacI transcriptional regulator SCH4B:60.22..61.16 kbp (936 bp) score=20
SCH4B_0280 transcriptional regulator, MerR family SCH4B:211.4..211.8 kbp (354 bp) score=20
SCH4B_0296 transcriptional regulator, TetR family SCH4B:224.1..224.8 kbp (639 bp) score=20
SCH4B_0320 transcriptional regulator, MarR family SCH4B:244.2..244.7 kbp (492 bp) score=20
SCH4B_0328 transcriptional regulator, Fis family SCH4B:254.6..255.6 kbp (960 bp) score=20
SCH4B_0332 transcriptional regulator, LysR family SCH4B:258.7..259.6 kbp (924 bp) score=20
SCH4B_0341 Bkd operon transcriptional regulator SCH4B:265.1..265.5 kbp (462 bp) score=20
SCH4B_0402 transcriptional regulator, LysR family SCH4B:315.6..316.5 kbp (939 bp) score=20
SCH4B_0463 transcriptional regulator, LuxR family SCH4B:368.1..368.8 kbp (720 bp) score=20
SCH4B_0508 transcriptional regulator, IclR family SCH4B:413.5..414.3 kbp (762 bp) score=20
SCH4B_0510 two component transcriptional regulator, winged helix family SCH4B:416.9..417.6 kbp (723 bp) score=20
SCH4B_0519 transcriptional regulator, RpiR family SCH4B:426.6..427.5 kbp (924 bp) score=20
SCH4B_0538 transcriptional regulator, LysR family SCH4B:449.3..450.2 kbp (888 bp) score=20
SCH4B_0573 transcriptional regulator, GntR family SCH4B:491..491.7 kbp (702 bp) score=20
SCH4B_0575 transcriptional regulator, ArsR family SCH4B:494.5..494.8 kbp (318 bp) score=20
SCH4B_0580 Bkd operon transcriptional regulator SCH4B:500.2..500.7 kbp (465 bp) score=20
SCH4B_0583 transcriptional regulator, TetR family SCH4B:504.3..505 kbp (675 bp) score=20
SCH4B_0603 transcriptional regulator, Fis family SCH4B:525.6..526.5 kbp (945 bp) score=20
phnF phosphonate metabolism transcriptional regulator PhnF SCH4B:530.6..531.3 kbp (723 bp) score=20
SCH4B_0615 LysR family transcriptional regulatory protein SCH4B:536.5..537.5 kbp (933 bp) score=20
SCH4B_0624 transcriptional regulator, IclR family SCH4B:546..546.7 kbp (780 bp) score=20
SCH4B_0630 transcriptional regulator, GntR family SCH4B:552.6..553.3 kbp (651 bp) score=20
SCH4B_0664 transcriptional regulator, GntR family SCH4B:575.9..576.6 kbp (717 bp) score=20
SCH4B_0668 putative transcriptional regulator MarR family protein SCH4B:579.7..580.1 kbp (453 bp) score=20
SCH4B_0674 transcriptional regulator, LysR family SCH4B:588.7..589.7 kbp (1.023 kbp) score=20
SCH4B_0675 transcriptional regulator, LysR family SCH4B:589.7..590.6 kbp (906 bp) score=20
SCH4B_0689 transcriptional regulator, GntR family SCH4B:605.4..606 kbp (657 bp) score=20
SCH4B_0701 periplasmic binding protein/LacI transcriptional regulator SCH4B:616.1..617 kbp (912 bp) score=20
SCH4B_0719 transcriptional regulator, LysR family SCH4B:636.2..637.1 kbp (888 bp) score=20
SCH4B_0721 putative transcriptional regulator MarR family protein SCH4B:638.5..639 kbp (495 bp) score=20
SCH4B_0764 transcriptional regulator, AraC family SCH4B:683..683.8 kbp (834 bp) score=20
SCH4B_0776 transcriptional regulator, GntR family SCH4B:694.7..695.4 kbp (756 bp) score=20
SCH4B_0793 transcriptional regulator, TetR family SCH4B:713.6..714.2 kbp (621 bp) score=20
SCH4B_0813 transcriptional regulator, LacI family SCH4B:737.4..738.5 kbp (1.101 kbp) score=20
SCH4B_0818 transcriptional regulator, ArsR family SCH4B:740.2..740.5 kbp (327 bp) score=20
SCH4B_0822 transcriptional regulator, LysR-family SCH4B:742.4..743.3 kbp (897 bp) score=20
SCH4B_0843 transcriptional regulator, GntR family SCH4B:764.6..766 kbp (1.467 kbp) score=20
SCH4B_0844 transcriptional regulator, ArsR family SCH4B:766.2..766.5 kbp (324 bp) score=20
SCH4B_0856 transcriptional regulator, AraC family SCH4B:775.8..776.7 kbp (945 bp) score=20
SCH4B_0871 transcriptional regulator, TetR family SCH4B:792.7..793.3 kbp (612 bp) score=20
SCH4B_0902 transcriptional regulator, LysR family SCH4B:818.8..819.7 kbp (876 bp) score=20
SCH4B_0942 transcriptional regulator, TetR family SCH4B:860..860.7 kbp (618 bp) score=20
SCH4B_0943 transcriptional regulator, ArsR family SCH4B:860.7..861.5 kbp (714 bp) score=20
SCH4B_0962 transcriptional regulator, MarR family SCH4B:879.8..880.2 kbp (471 bp) score=20
SCH4B_0969 transcriptional regulator, LysR family SCH4B:886.6..887.6 kbp (915 bp) score=20
SCH4B_1103 transcriptional regulator, GntR family SCH4B:1.005..1.006 Mbp (666 bp) score=20
SCH4B_1138 two component, sigma54 specific, transcriptional regulator, Fis family SCH4B:1.041..1.042 Mbp (1.251 kbp) score=20
SCH4B_1142 transcriptional regulatory protein RtcR SCH4B:1.048..1.049 Mbp (924 bp) score=20
SCH4B_1143 transcriptional regulatory protein RtcR SCH4B:1.049..1.05 Mbp (624 bp) score=20
SCH4B_1158 transcriptional regulator, TetR family SCH4B:1.061..1.061 Mbp (624 bp) score=20
SCH4B_1188 transcriptional regulator, LysR family SCH4B:1.092..1.093 Mbp (933 bp) score=20
SCH4B_1196 transcriptional regulator, IclR family SCH4B:1.104..1.105 Mbp (795 bp) score=20
SCH4B_1200 transcriptional regulator, GntR family SCH4B:1.108..1.108 Mbp (699 bp) score=20
SCH4B_1245 two component, sigma54 specific, transcriptional regulator, Fis family SCH4B:1.149..1.15 Mbp (1.353 kbp) score=20
SCH4B_1275 transcriptional regulator, LacI family SCH4B:1.178..1.179 Mbp (1.032 kbp) score=20
SCH4B_1284 transcriptional regulator, TetR family SCH4B:1.19..1.191 Mbp (597 bp) score=20
SCH4B_1314 transcriptional regulator, LysR family SCH4B:1.221..1.222 Mbp (849 bp) score=20
SCH4B_1369 transcriptional regulator, AsnC family SCH4B:1.282..1.282 Mbp (456 bp) score=20
SCH4B_1370 transcriptional regulator, AsnC family SCH4B:1.282..1.283 Mbp (459 bp) score=20
SCH4B_1375 transcriptional regulator, GntR family SCH4B:1.286..1.287 Mbp (669 bp) score=20
SCH4B_1394 putative transcriptional regulator SCH4B:1.308..1.309 Mbp (468 bp) score=20
SCH4B_1406 putative transcriptional regulator SCH4B:1.319..1.32 Mbp (804 bp) score=20
SCH4B_1420 transcriptional regulator, LysR family SCH4B:1.336..1.337 Mbp (933 bp) score=20
SCH4B_1427 transcriptional regulator, MarR family SCH4B:1.343..1.343 Mbp (495 bp) score=20
SCH4B_1445 transcriptional regulator SCH4B:1.363..1.363 Mbp (351 bp) score=20
SCH4B_1476 transcriptional regulator, LysR family SCH4B:1.39..1.391 Mbp (843 bp) score=20
SCH4B_1488 transcriptional regulator, AraC family SCH4B:1.402..1.403 Mbp (1.032 kbp) score=20
SCH4B_1492 transcriptional regulator, XRE family SCH4B:1.407..1.407 Mbp (864 bp) score=20
SCH4B_1511 transcriptional regulator, GntR family SCH4B:1.422..1.424 Mbp (1.305 kbp) score=20
SCH4B_1518 transcriptional regulator, TetR family SCH4B:1.429..1.43 Mbp (630 bp) score=20
SCH4B_1529 transcriptional regulator, XRE family with cupin sensor SCH4B:1.439..1.44 Mbp (651 bp) score=20
nrdR transcriptional regulator NrdR SCH4B:1.462..1.463 Mbp (468 bp) score=20
SCH4B_1575 transcriptional regulator, IclR family SCH4B:1.483..1.483 Mbp (807 bp) score=20
SCH4B_1619 transcriptional regulator, LysR family SCH4B:1.524..1.525 Mbp (978 bp) score=20
SCH4B_1631 transcriptional regulator, LysR family SCH4B:1.54..1.541 Mbp (915 bp) score=20
SCH4B_1655 transcriptional regulator, AraC family SCH4B:1.556..1.557 Mbp (747 bp) score=20
SCH4B_1657 transcriptional regulator SCH4B:1.557..1.558 Mbp (609 bp) score=20
SCH4B_1728 prophage transcriptional regulator SCH4B:1.619..1.62 Mbp (654 bp) score=20
SCH4B_1739 transcriptional regulator, TraR/DksA family SCH4B:1.627..1.627 Mbp (294 bp) score=20
SCH4B_1770 transcriptional regulator, TetR family SCH4B:1.658..1.658 Mbp (555 bp) score=20
SCH4B_1785 transcriptional regulator, Crp/Fnr family SCH4B:1.671..1.672 Mbp (669 bp) score=20
SCH4B_1817 transcriptional regulator, TetR family SCH4B:1.702..1.703 Mbp (582 bp) score=20
SCH4B_1836 transcriptional regulator, LysR family SCH4B:1.713..1.714 Mbp (918 bp) score=20
SCH4B_1837 transcriptional regulator, XRE family SCH4B:1.715..1.716 Mbp (375 bp) score=20
SCH4B_1872 transcriptional regulator, XRE family SCH4B:1.748..1.75 Mbp (1.389 kbp) score=20
SCH4B_1893 HTH-type transcriptional regulator TrpI SCH4B:1.767..1.768 Mbp (900 bp) score=20
SCH4B_1907 transcriptional regulator, AsnC family SCH4B:1.78..1.781 Mbp (375 bp) score=20
SCH4B_1921 transcriptional regulator, LysR family SCH4B:1.794..1.795 Mbp (882 bp) score=20
SCH4B_1958 C4-dicarboxylate transport transcriptional regulatory protein DctD SCH4B:1.832..1.834 Mbp (1.254 kbp) score=20
SCH4B_2021 transcriptional regulator, AsnC family SCH4B:1.892..1.892 Mbp (168 bp) score=20
SCH4B_2035 transcriptional regulator, TetR family SCH4B:1.912..1.912 Mbp (594 bp) score=20
SCH4B_2046 transcriptional regulator, TetR family SCH4B:1.924..1.925 Mbp (606 bp) score=20
SCH4B_2066 transcriptional regulator, LysR family SCH4B:1.946..1.947 Mbp (882 bp) score=20
SCH4B_2077 transcriptional regulator, MerR family SCH4B:1.959..1.959 Mbp (402 bp) score=20
SCH4B_2078 transcriptional regulator, MerR family SCH4B:1.96..1.96 Mbp (369 bp) score=20
SCH4B_2088 transcriptional regulator, MarR family SCH4B:1.967..1.968 Mbp (471 bp) score=20
SCH4B_2108 transcriptional regulator, AraC family SCH4B:1.988..1.989 Mbp (1.008 kbp) score=20
SCH4B_2121 transcriptional regulator, LuxR family SCH4B:1.998..1.998 Mbp (537 bp) score=20
SCH4B_2127 transcriptional regulator, XRE family SCH4B:2.004..2.005 Mbp (1.332 kbp) score=20
SCH4B_2139 transcriptional regulator, TetR family SCH4B:2.015..2.016 Mbp (615 bp) score=20
SCH4B_2159 transcriptional regulator, LysR family SCH4B:2.036..2.037 Mbp (930 bp) score=20
SCH4B_2177 two component, sigma54 specific, transcriptional regulator, Fis family SCH4B:2.053..2.054 Mbp (1.251 kbp) score=20
SCH4B_2193 transcriptional regulator, GntR family SCH4B:2.069..2.07 Mbp (732 bp) score=20
SCH4B_2226 transcriptional regulator, AraC family SCH4B:2.105..2.105 Mbp (537 bp) score=20
SCH4B_2243 cell cycle transcriptional regulator CtrA SCH4B:2.121..2.122 Mbp (720 bp) score=20
SCH4B_2256 transcriptional regulator, GntR family SCH4B:2.133..2.135 Mbp (1.416 kbp) score=20
SCH4B_2260 transcriptional regulator, TetR family SCH4B:2.138..2.139 Mbp (618 bp) score=20
SCH4B_2298 transcriptional regulator, XRE family SCH4B:2.182..2.183 Mbp (630 bp) score=20
SCH4B_2319 putative transcriptional regulatory protein, MarR family SCH4B:2.2..2.2 Mbp (495 bp) score=20
SCH4B_2329 transcriptional regulator, AraC family SCH4B:2.21..2.211 Mbp (1.005 kbp) score=20
phoB phosphate regulon transcriptional regulatory protein PhoB SCH4B:2.224..2.225 Mbp (690 bp) score=20
SCH4B_2344 transcriptional regulator, LysR family SCH4B:2.225..2.226 Mbp (912 bp) score=20
SCH4B_2348 transcriptional regulator, RpiR family SCH4B:2.23..2.231 Mbp (888 bp) score=20
SCH4B_2361 transcriptional regulator, BadM/Rrf2 family SCH4B:2.244..2.244 Mbp (429 bp) score=20
SCH4B_2363 transcriptional regulator, CarD family SCH4B:2.244..2.245 Mbp (582 bp) score=20
SCH4B_2374 transcriptional regulator, TraR/DksA family SCH4B:2.254..2.254 Mbp (270 bp) score=20
SCH4B_2394 transcriptional regulator, MarR family SCH4B:2.271..2.272 Mbp (504 bp) score=20
SCH4B_2399 transcriptional regulator, DeoR family SCH4B:2.28..2.281 Mbp (825 bp) score=20
SCH4B_2438 transcriptional regulator, sarp family SCH4B:2.333..2.334 Mbp (1.665 kbp) score=20
cueR Cu(I)-responsive transcriptional regulator SCH4B:2.336..2.337 Mbp (402 bp) score=20
SCH4B_2452 transcriptional regulator, ArsR family SCH4B:2.353..2.354 Mbp (831 bp) score=20
SCH4B_2468 transcriptional regulator, LysR family SCH4B:2.369..2.37 Mbp (909 bp) score=20
SCH4B_2472 transcriptional regulator, GntR family SCH4B:2.373..2.373 Mbp (663 bp) score=20
SCH4B_2500 transcriptional regulator, TetR family SCH4B:2.402..2.402 Mbp (585 bp) score=20
SCH4B_2583 transcriptional regulator, AraC family SCH4B:2.494..2.495 Mbp (1.029 kbp) score=20
SCH4B_2602 transcriptional regulatory protein ChvI SCH4B:2.512..2.513 Mbp (702 bp) score=20
SCH4B_2611 transcriptional regulator, AraC family SCH4B:2.522..2.522 Mbp (852 bp) score=20
SCH4B_2615 transcriptional regulator, MarR family SCH4B:2.527..2.528 Mbp (489 bp) score=20
SCH4B_2621 transcriptional regulator, LysR family SCH4B:2.533..2.534 Mbp (906 bp) score=20
SCH4B_2652 transcriptional regulator, XRE family SCH4B:2.556..2.556 Mbp (564 bp) score=20
SCH4B_2665 transcriptional regulator, TetR family SCH4B:2.571..2.571 Mbp (603 bp) score=20
SCH4B_2716 transcriptional regulator, LysR family SCH4B:2.617..2.618 Mbp (885 bp) score=20
SCH4B_2769 transcriptional regulator, GntR family SCH4B:2.664..2.665 Mbp (822 bp) score=20
SCH4B_2776 transcriptional regulator, ArsR family SCH4B:2.67..2.67 Mbp (330 bp) score=20
SCH4B_2778 transcriptional regulator, LysR family SCH4B:2.671..2.672 Mbp (879 bp) score=20
SCH4B_2794 transcriptional regulator, MerR family SCH4B:2.682..2.683 Mbp (426 bp) score=20
SCH4B_2801 transcriptional regulator, MarR family SCH4B:2.688..2.688 Mbp (459 bp) score=20
SCH4B_2820 transcriptional regulator, RpiR family SCH4B:2.708..2.708 Mbp (831 bp) score=20
SCH4B_2821 periplasmic binding protein/LacI transcriptional regulator SCH4B:2.709..2.71 Mbp (927 bp) score=20
SCH4B_2834 putative transcriptional regulator RpiR family protein SCH4B:2.722..2.723 Mbp (960 bp) score=20
SCH4B_2856 transcriptional regulator, AsnC family SCH4B:2.746..2.746 Mbp (429 bp) score=20
SCH4B_2875 transcriptional regulator, DeoR family SCH4B:2.763..2.763 Mbp (753 bp) score=20
SCH4B_2891 transcriptional regulator, sarp family SCH4B:2.785..2.787 Mbp (1.629 kbp) score=20
SCH4B_2896 transcriptional regulator, GntR family SCH4B:2.793..2.794 Mbp (789 bp) score=20
SCH4B_2902 transcriptional regulator, AsnC family SCH4B:2.8..2.801 Mbp (480 bp) score=20
SCH4B_2904 transcriptional regulator, AraC family SCH4B:2.802..2.803 Mbp (1.02 kbp) score=20
SCH4B_2918 transcriptional regulator, LysR family SCH4B:2.814..2.815 Mbp (909 bp) score=20
SCH4B_2923 transcriptional regulator, AsnC family SCH4B:2.822..2.822 Mbp (486 bp) score=20
SCH4B_2929 transcriptional regulator, XRE family with cupin sensor SCH4B:2.828..2.829 Mbp (615 bp) score=20
SCH4B_2958 transcriptional regulator, AsnC family SCH4B:2.853..2.854 Mbp (459 bp) score=20
SCH4B_3004 transcriptional regulator, AsnC family SCH4B:2.91..2.911 Mbp (513 bp) score=20
SCH4B_3013 transcriptional regulator, RpiR family SCH4B:2.919..2.92 Mbp (858 bp) score=20
SCH4B_3017 transcriptional regulator, LysR family SCH4B:2.925..2.926 Mbp (924 bp) score=20
SCH4B_3022 transcriptional regulator, AraC family SCH4B:2.93..2.931 Mbp (948 bp) score=20
SCH4B_3041 transcriptional regulator, PadR family SCH4B:2.953..2.953 Mbp (357 bp) score=20
SCH4B_3142 transcriptional regulator, GntR family SCH4B:3.045..3.046 Mbp (720 bp) score=20
SCH4B_3230 transcriptional regulator, MarR family SCH4B:3.13..3.13 Mbp (441 bp) score=20
SCH4B_3251 transcriptional regulator, MarR family SCH4B:3.154..3.155 Mbp (513 bp) score=20
SCH4B_3255 transcriptional regulator, MarR family SCH4B:3.156..3.157 Mbp (432 bp) score=20
SCH4B_3258 transcriptional regulator, MerR family SCH4B:3.159..3.159 Mbp (417 bp) score=20
SCH4B_3313 transcriptional regulator, GntR family SCH4B:3.21..3.21 Mbp (687 bp) score=20
SCH4B_3328 transcriptional regulator, GntR family SCH4B:3.229..3.23 Mbp (744 bp) score=20
SCH4B_3338 transcriptional regulator, GntR family SCH4B:3.239..3.24 Mbp (627 bp) score=20
SCH4B_3356 transcriptional regulator, XRE family with cupin sensor SCH4B:3.254..3.254 Mbp (567 bp) score=20
SCH4B_3366 transcriptional regulator, TetR family SCH4B:3.265..3.266 Mbp (588 bp) score=20
SCH4B_3409 transcriptional regulator, AsnC family SCH4B:3.31..3.31 Mbp (477 bp) score=20
SCH4B_3412 putative transcriptional regulator GntR family protein SCH4B:3.313..3.314 Mbp (657 bp) score=20
SCH4B_3426 two component transcriptional regulator, winged helix family SCH4B:3.328..3.329 Mbp (687 bp) score=20
SCH4B_3438 transcriptional regulatory protein SCH4B:3.341..3.342 Mbp (771 bp) score=20
SCH4B_3449 transcriptional regulator, AraC family SCH4B:3.35..3.351 Mbp (714 bp) score=20
SCH4B_3491 two component transcriptional regulator, winged helix family SCH4B:3.394..3.395 Mbp (720 bp) score=20
SCH4B_3499 transcriptional regulator, Fis family SCH4B:3.403..3.404 Mbp (1.284 kbp) score=20
SCH4B_3542 transcriptional regulatory protein ChvI SCH4B:3.449..3.45 Mbp (693 bp) score=20
SCH4B_3556 transcriptional regulator, GntR family SCH4B:3.463..3.464 Mbp (690 bp) score=20
SCH4B_3570 transcriptional regulator, LacI family SCH4B:3.477..3.478 Mbp (1.089 kbp) score=20
SCH4B_3575 transcriptional regulator, LacI family SCH4B:3.481..3.482 Mbp (1.032 kbp) score=20
SCH4B_3596 periplasmic binding protein/LacI transcriptional regulator SCH4B:3.501..3.502 Mbp (1.035 kbp) score=20
SCH4B_3616 transcriptional regulator, LysR family SCH4B:3.518..3.519 Mbp (936 bp) score=20
SCH4B_3634 transcriptional regulatory protein DegU SCH4B:3.536..3.537 Mbp (639 bp) score=20
SCH4B_3650 transcriptional regulator, XRE family SCH4B:3.551..3.552 Mbp (402 bp) score=20
SCH4B_3652 transcriptional regulator, MarR family SCH4B:3.552..3.553 Mbp (498 bp) score=20
SCH4B_3669 transcriptional regulator, GntR family SCH4B:3.566..3.567 Mbp (666 bp) score=20
SCH4B_3687 transcriptional regulator, LysR family SCH4B:3.582..3.582 Mbp (918 bp) score=20
SCH4B_3703 transcriptional regulator, TetR family SCH4B:3.6..3.601 Mbp (609 bp) score=20
SCH4B_3718 transcriptional regulator, LysR family SCH4B:3.615..3.616 Mbp (915 bp) score=20
SCH4B_3749 transcriptional regulator, LysR family SCH4B:3.644..3.645 Mbp (966 bp) score=20
SCH4B_3774 transcriptional regulator, LysR family SCH4B:3.668..3.669 Mbp (912 bp) score=20
SCH4B_3784 transcriptional regulator, LysR family SCH4B:3.677..3.678 Mbp (918 bp) score=20
SCH4B_3783 transcriptional regulator, XRE family with cupin sensor SCH4B:3.678..3.679 Mbp (573 bp) score=20
SCH4B_3794 transcriptional regulator, sarp family SCH4B:3.688..3.69 Mbp (1.725 kbp) score=20
SCH4B_3808 transcriptional regulator, Crp/Fnr family SCH4B:3.7..3.7 Mbp (666 bp) score=20
SCH4B_3824 transcriptional regulator, GntR family SCH4B:3.718..3.718 Mbp (762 bp) score=20
SCH4B_3885 transcriptional regulator, AsnC family SCH4B:3.777..3.778 Mbp (471 bp) score=20
SCH4B_3908 transcriptional regulator, LysR family SCH4B:3.801..3.802 Mbp (876 bp) score=20
SCH4B_3923 transcriptional regulator, AsnC family SCH4B:3.817..3.817 Mbp (501 bp) score=20
SCH4B_3939 transcriptional regulator, MarR family SCH4B:3.829..3.829 Mbp (483 bp) score=20
SCH4B_3951 transcriptional regulator, LysR family SCH4B:3.844..3.845 Mbp (1.155 kbp) score=20
SCH4B_3976 transcriptional regulator, AraC family SCH4B:3.87..3.87 Mbp (894 bp) score=20
SCH4B_3995 transcriptional regulator, LysR family SCH4B:3.887..3.888 Mbp (966 bp) score=20
SCH4B_4110 transcriptional regulator, MerR family SCH4B:4.005..4.005 Mbp (462 bp) score=20
SCH4B_4113 transcriptional regulator, MerR family SCH4B:4.008..4.008 Mbp (375 bp) score=20
SCH4B_4122 transcriptional regulator, TetR family SCH4B:4.016..4.017 Mbp (675 bp) score=20
SCH4B_4133 transcriptional regulator, ArsR family SCH4B:4.026..4.027 Mbp (342 bp) score=20
SCH4B_4153 transcriptional regulator, GntR family SCH4B:4.045..4.046 Mbp (729 bp) score=20
SCH4B_4159 transcriptional regulator, LysR family SCH4B:4.056..4.057 Mbp (888 bp) score=20
SCH4B_4179 transcriptional regulator AhyR/asaR family SCH4B:4.078..4.079 Mbp (690 bp) score=20
SCH4B_4186 transcriptional regulator, LysR family SCH4B:4.086..4.087 Mbp (912 bp) score=20
SCH4B_4199 transcriptional regulator SCH4B:4.1..4.101 Mbp (1.029 kbp) score=20
SCH4B_4229 transcriptional regulator, HxlR family SCH4B:4.123..4.124 Mbp (654 bp) score=20
SCH4B_4249 transcriptional regulator, XRE family SCH4B:4.144..4.145 Mbp (762 bp) score=20
SCH4B_4255 two component transcriptional regulator, LuxR family SCH4B:4.148..4.149 Mbp (645 bp) score=20
SCH4B_4278 transcriptional regulator, TraR/DksA family SCH4B:4.172..4.172 Mbp (477 bp) score=20
SCH4B_4294 transcriptional regulator, AsnC family SCH4B:4.186..4.187 Mbp (525 bp) score=20
SCH4B_4297 transcriptional regulator, MerR family SCH4B:4.188..4.191 Mbp (2.106 kbp) score=20
SCH4B_4382 transcriptional regulatory protein, C SCH4B:4.257..4.257 Mbp (522 bp) score=20
SCH4B_4412 two component transcriptional regulator, LuxR family SCH4B:4.285..4.285 Mbp (645 bp) score=20
SCH4B_4442 transcriptional regulator SCH4B:4.313..4.314 Mbp (579 bp) score=20
SCH4B_4571 transcriptional regulator, XRE family SCH4B:4.442..4.442 Mbp (768 bp) score=20
SCH4B_4577 transcriptional regulator, LysR family SCH4B:4.45..4.451 Mbp (897 bp) score=20
SCH4B_4590 transcriptional regulator, LysR family SCH4B:4.463..4.464 Mbp (906 bp) score=20
SCH4B_4640 transcriptional regulator, AsnC family SCH4B:4.515..4.515 Mbp (438 bp) score=20
SCH4B_4682 transcriptional regulator, LuxR family SCH4B:4.549..4.55 Mbp (756 bp) score=20
SCH4B_4768 transcriptional regulator, GntR family SCH4B:4.628..4.629 Mbp (702 bp) score=20
SCH4B_4774 transcriptional regulator SCH4B:4.635..4.635 Mbp (807 bp) score=20
SCH4B_4798 transcriptional regulator, IclR-family SCH4B:4.652..4.653 Mbp (654 bp) score=20
SCH4B_0286 response regulator receiver protein SCH4B:215..215.4 kbp (387 bp) score=10
SCH4B_0290 response regulator receiver protein SCH4B:218.9..219.2 kbp (375 bp) score=10
SCH4B_0311 response regulator receiver sensor signal transduction histidine kinase SCH4B:237.1..237.8 kbp (732 bp) score=10
SCH4B_0313 response regulator receiver protein SCH4B:240.2..240.7 kbp (471 bp) score=10
SCH4B_0314 response regulator receiver sensor signal transduction histidine kinase SCH4B:240.6..241.7 kbp (1.101 kbp) score=10
SCH4B_0377 manganese transport regulator MntR SCH4B:296.8..297.2 kbp (435 bp) score=10
soxR redox-sensitive transcriptional activator SoxR SCH4B:307..307.5 kbp (456 bp) score=10
SCH4B_0762 leucine-responsive regulatory protein SCH4B:681.7..682.2 kbp (453 bp) score=10
betI_2 transcriptional repressor BetI SCH4B:686.7..687.3 kbp (576 bp) score=10
SCH4B_0821 regulatory protein, ArsR SCH4B:741.6..742 kbp (372 bp) score=10
SCH4B_0876 ferric uptake regulator, Fur family SCH4B:797..797.4 kbp (429 bp) score=10
SCH4B_1256 transcriptional activator ChrR SCH4B:1.16..1.16 Mbp (636 bp) score=10
SCH4B_1422 response regulator receiver domain protein SCH4B:1.337..1.338 Mbp (576 bp) score=10
SCH4B_1503 response regulator receiver modulated diguanylate cyclase SCH4B:1.414..1.415 Mbp (1.404 kbp) score=10
SCH4B_1525 regulatory protein SCH4B:1.434..1.435 Mbp (1.356 kbp) score=10
SCH4B_1585 glutamate uptake regulatory protein SCH4B:1.49..1.491 Mbp (462 bp) score=10
SCH4B_1827 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD SCH4B:1.709..1.71 Mbp (660 bp) score=10
betI_1 transcriptional repressor BetI SCH4B:1.741..1.742 Mbp (591 bp) score=10
SCH4B_2022 glutamate uptake regulatory protein SCH4B:1.892..1.893 Mbp (348 bp) score=10
SCH4B_2128 response regulator receiver protein SCH4B:2.005..2.006 Mbp (408 bp) score=10
SCH4B_2282 nitrogen assimilation regulatory protein SCH4B:2.159..2.16 Mbp (1.38 kbp) score=10
SCH4B_2284 nitrogen assimilation regulatory protein NtrX SCH4B:2.163..2.164 Mbp (1.419 kbp) score=10
phoU phosphate transport system regulatory protein PhoU SCH4B:2.223..2.224 Mbp (711 bp) score=10
SCH4B_2477 ATP phosphoribosyltransferase regulatory subunit SCH4B:2.376..2.377 Mbp (1.092 kbp) score=10
SCH4B_2511 response regulator receiver protein SCH4B:2.41..2.411 Mbp (1.245 kbp) score=10
SCH4B_2593 transcriptional repressor, CopY family SCH4B:2.505..2.505 Mbp (396 bp) score=10
SCH4B_2723 transcriptional activator protein FnrL SCH4B:2.623..2.624 Mbp (786 bp) score=10
SCH4B_2810 nitrogen regulatory protein P-II SCH4B:2.698..2.699 Mbp (339 bp) score=10
SCH4B_2851 response regulator receiver protein SCH4B:2.74..2.741 Mbp (702 bp) score=10
SCH4B_2937 two-component response regulator SCH4B:2.834..2.835 Mbp (822 bp) score=10
SCH4B_2953 DNA-binding response regulator SCH4B:2.846..2.847 Mbp (666 bp) score=10
SCH4B_3161 DNA-binding response regulator SCH4B:3.063..3.064 Mbp (555 bp) score=10
SCH4B_3211 response regulator receiver modulated serine phosphatase SCH4B:3.113..3.114 Mbp (1.272 kbp) score=10
SCH4B_3250 DNA-binding response regulator SCH4B:3.153..3.154 Mbp (702 bp) score=10
SCH4B_3301 flagellar biosynthesis regulatory protein FlaF SCH4B:3.199..3.199 Mbp (372 bp) score=10
SCH4B_3383 nitrogen regulatory protein SCH4B:3.284..3.285 Mbp (465 bp) score=10
SCH4B_3441 putative anti-sigma regulatory factor, serine/threonine protein kinase SCH4B:3.344..3.344 Mbp (441 bp) score=10
SCH4B_3531 transcriptional activator protein CopR SCH4B:3.437..3.438 Mbp (672 bp) score=10
SCH4B_3635 response regulator receiver domain protein SCH4B:3.537..3.539 Mbp (2.022 kbp) score=10
SCH4B_3682 regulatory prophage protein SCH4B:3.578..3.578 Mbp (429 bp) score=10
SCH4B_3729 regulatory protein, IclR SCH4B:3.625..3.626 Mbp (810 bp) score=10
SCH4B_3777 periplasmic sensory protein associated with the TorRS two-component regulatory system SCH4B:3.672..3.673 Mbp (1.071 kbp) score=10
SCH4B_3793 nitrate/nitrite regulatory protein NarP SCH4B:3.687..3.687 Mbp (675 bp) score=10
SCH4B_3800 regulatory protein, ArsR SCH4B:3.693..3.694 Mbp (375 bp) score=10
SCH4B_3818 regulatory protein LacI SCH4B:3.711..3.712 Mbp (1.029 kbp) score=10
SCH4B_3833 proline dehydrogenase transcriptional activator SCH4B:3.727..3.727 Mbp (477 bp) score=10
metR transcriptional activator MetR SCH4B:3.733..3.734 Mbp (906 bp) score=10
SCH4B_3896 regulatory protein, MarR SCH4B:3.79..3.791 Mbp (525 bp) score=10
SCH4B_3947 response regulator receiver protein SCH4B:3.842..3.842 Mbp (720 bp) score=10
SCH4B_3979 GcrA cell cycle regulator SCH4B:3.871..3.872 Mbp (591 bp) score=10
SCH4B_4168 response regulator receiver protein SCH4B:4.07..4.07 Mbp (456 bp) score=10
SCH4B_4219 nitrite and nitric oxide reductase regulator SCH4B:4.115..4.116 Mbp (696 bp) score=10
SCH4B_4315 manganese uptake regulator, Fur family SCH4B:4.206..4.207 Mbp (417 bp) score=10
SCH4B_4489 nitrogen regulatory protein P-II SCH4B:4.355..4.356 Mbp (339 bp) score=10
SCH4B_4496 response regulator receiver protein SCH4B:4.368..4.369 Mbp (384 bp) score=10
SCH4B_4498 response regulator receiver protein SCH4B:4.371..4.371 Mbp (396 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70