Roseobase: Ruegeria sp. TW15

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RTW15:859872..862145, RTW15_010100000020, dmdA, ZP_08861014, RTW15_010100r10238, RTW15_010100t20367, transcriptional regulator, KGKKMAGHMGAARVTTQNLEVVKTDSDRNLVFIKGAVPGP.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 322 regions match your request.
Matches on RTW15
overview_RTW15
RTW15_010100000035 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:4.876..5.382 kbp (507 bp) score=40
RTW15_010100000355 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:56.68..57.59 kbp (912 bp) score=40
RTW15_010100000360 transcriptional regulator COG0583 Transcriptional regulator RTW15:57.76..58.68 kbp (924 bp) score=40
RTW15_010100000415 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RTW15:69.51..70.18 kbp (672 bp) score=40
RTW15_010100000505 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RTW15:85.19..85.86 kbp (672 bp) score=40
RTW15_010100000530 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:92.06..92.63 kbp (570 bp) score=40
RTW15_010100000545 HTH-type GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:94.98..95.65 kbp (669 bp) score=40
RTW15_010100000715 Cu(I)-responsive transcriptional regulator COG0789 Predicted transcriptional regulators RTW15:122.3..122.7 kbp (387 bp) score=40
RTW15_010100000740 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RTW15:126.8..127.7 kbp (903 bp) score=40
RTW15_010100000760 transcriptional regulator COG1802 Transcriptional regulators RTW15:131.9..132.5 kbp (666 bp) score=40
RTW15_010100000970 RpiR family transcriptional regulator COG1737 Transcriptional regulators RTW15:183.5..184.3 kbp (810 bp) score=40
RTW15_010100001110 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:209..209.6 kbp (642 bp) score=40
RTW15_010100001155 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:220.2..220.8 kbp (588 bp) score=40
RTW15_010100001185 transcriptional regulator COG1414 Transcriptional regulator RTW15:228..228.8 kbp (780 bp) score=40
RTW15_010100001385 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:270.4..270.8 kbp (453 bp) score=40
RTW15_010100001515 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:290.3..291.2 kbp (879 bp) score=40
RTW15_010100001535 ArsR family transcriptional regulator COG0640 Predicted transcriptional regulators RTW15:292.9..293.3 kbp (333 bp) score=40
RTW15_010100002219 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:416.1..416.7 kbp (597 bp) score=40
RTW15_010100002309 IclR family transcriptional regulator COG1414 Transcriptional regulator RTW15:437.3..438.1 kbp (762 bp) score=40
RTW15_010100002424 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:464.8..465.5 kbp (684 bp) score=40
RTW15_010100002439 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:470.4..470.8 kbp (462 bp) score=40
RTW15_010100002454 ArsR family transcriptional regulator COG0640 Predicted transcriptional regulators RTW15:474.4..474.7 kbp (288 bp) score=40
RTW15_010100002524 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:485.5..486.2 kbp (723 bp) score=40
RTW15_010100002689 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:514.7..515.6 kbp (882 bp) score=40
RTW15_010100002719 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:527.6..528.5 kbp (915 bp) score=40
RTW15_010100003191 HTH-type DeoR family transcriptional regulator COG1349 Transcriptional regulators of sugar metabolism RTW15:621.7..622.6 kbp (933 bp) score=40
RTW15_010100003751 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:731.4..732.3 kbp (906 bp) score=40
RTW15_010100003761 HTH-type ArsR family transcriptional regulator COG0640 Predicted transcriptional regulators RTW15:733..733.7 kbp (681 bp) score=40
RTW15_010100003801 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RTW15:738.5..738.9 kbp (390 bp) score=40
RTW15_010100003821 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:741.3..741.8 kbp (438 bp) score=40
RTW15_010100003881 transcriptional regulator protein COG0640 Predicted transcriptional regulators RTW15:753.2..753.5 kbp (354 bp) score=40
RTW15_010100003956 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:765.5..766.4 kbp (858 bp) score=40
RTW15_010100004216 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:822.9..823.8 kbp (894 bp) score=40
RTW15_010100004486 MerR family transcriptional regulator COG0789 Predicted transcriptional regulators RTW15:878.6..879 kbp (402 bp) score=40
RTW15_010100004491 MerR family transcriptional regulator COG0789 Predicted transcriptional regulators RTW15:879.1..879.5 kbp (369 bp) score=40
RTW15_010100004816 RpiR family transcriptional regulator COG1737 Transcriptional regulators RTW15:944.9..945.7 kbp (807 bp) score=40
RTW15_010100004916 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:962.3..962.8 kbp (492 bp) score=40
RTW15_010100005386 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:1.051..1.051 Mbp (498 bp) score=40
RTW15_010100005391 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:1.051..1.052 Mbp (459 bp) score=40
RTW15_010100005396 GntR family transcriptional regulator COG2188 Transcriptional regulators RTW15:1.052..1.052 Mbp (702 bp) score=40
RTW15_010100005421 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:1.056..1.057 Mbp (648 bp) score=40
RTW15_010100005531 GntR family transcriptional regulator COG2188 Transcriptional regulators RTW15:1.082..1.082 Mbp (756 bp) score=40
RTW15_010100005616 CarD family transcriptional regulator COG1329 Transcriptional regulators, similar to M. xanthus CarD RTW15:1.099..1.1 Mbp (510 bp) score=40
RTW15_010100005641 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:1.104..1.105 Mbp (456 bp) score=40
RTW15_010100005696 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:1.116..1.117 Mbp (609 bp) score=40
RTW15_010100005901 AsnC/Lrp family transcriptional regulator COG1522 Transcriptional regulators RTW15:1.157..1.157 Mbp (429 bp) score=40
RTW15_010100006166 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.22..1.221 Mbp (879 bp) score=40
RTW15_010100006206 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:1.23..1.231 Mbp (615 bp) score=40
RTW15_010100006266 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.242..1.243 Mbp (924 bp) score=40
RTW15_010100006351 RpiR family transcriptional regulator COG1737 Transcriptional regulators RTW15:1.259..1.26 Mbp (900 bp) score=40
RTW15_010100006406 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:1.267..1.268 Mbp (474 bp) score=40
RTW15_010100006571 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.302..1.303 Mbp (903 bp) score=40
RTW15_010100006651 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.318..1.319 Mbp (909 bp) score=40
RTW15_010100006831 GntR family transcriptional regulator COG2186 Transcriptional regulators RTW15:1.352..1.353 Mbp (732 bp) score=40
RTW15_010100006996 GntR family transcriptional regulator COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RTW15:1.383..1.384 Mbp (1.404 kbp) score=40
RTW15_010100007236 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.426..1.427 Mbp (912 bp) score=40
RTW15_010100007301 transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:1.439..1.44 Mbp (1.005 kbp) score=40
RTW15_010100008281 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:1.647..1.647 Mbp (510 bp) score=40
RTW15_010100008431 AraC family transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:1.673..1.674 Mbp (1.011 kbp) score=40
RTW15_010100008636 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:1.714..1.715 Mbp (711 bp) score=40
RTW15_010100008641 transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:1.715..1.716 Mbp (951 bp) score=40
RTW15_010100008656 putative TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:1.717..1.718 Mbp (516 bp) score=40
RTW15_010100008706 MerR family transcriptional regulator COG0789 Predicted transcriptional regulators RTW15:1.725..1.726 Mbp (588 bp) score=40
RTW15_010100008896 ArsR family transcriptional regulator COG0640 Predicted transcriptional regulators RTW15:1.758..1.759 Mbp (330 bp) score=40
RTW15_010100008976 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:1.771..1.771 Mbp (600 bp) score=40
RTW15_010100009006 transcriptional regulator COG1309 Transcriptional regulator RTW15:1.775..1.776 Mbp (594 bp) score=40
RTW15_010100009061 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:1.786..1.787 Mbp (684 bp) score=40
RTW15_010100009416 AraC family transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:1.852..1.853 Mbp (981 bp) score=40
RTW15_010100009516 transcriptional regulator COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RTW15:1.874..1.875 Mbp (1.461 kbp) score=40
RTW15_010100009521 ArsR family transcriptional regulator COG0640 Predicted transcriptional regulators RTW15:1.875..1.876 Mbp (309 bp) score=40
RTW15_010100009706 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.908..1.909 Mbp (876 bp) score=40
RTW15_010100009781 GntR family transcriptional regulator COG2188 Transcriptional regulators RTW15:1.925..1.926 Mbp (711 bp) score=40
RTW15_010100009856 Cu(I)-responsive transcriptional regulator COG0789 Predicted transcriptional regulators RTW15:1.941..1.941 Mbp (390 bp) score=40
RTW15_010100009886 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.947..1.947 Mbp (900 bp) score=40
RTW15_010100009911 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.953..1.954 Mbp (852 bp) score=40
RTW15_010100009916 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.954..1.955 Mbp (903 bp) score=40
RTW15_010100009946 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.962..1.963 Mbp (879 bp) score=40
RTW15_010100010096 XRE family transcriptional regulator COG1396 Predicted transcriptional regulators RTW15:1.989..1.989 Mbp (555 bp) score=40
RTW15_010100010111 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:1.992..1.993 Mbp (663 bp) score=40
RTW15_010100010146 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:1.998..1.999 Mbp (945 bp) score=40
RTW15_010100010408 IclR family transcriptional regulator COG1414 Transcriptional regulator RTW15:2.061..2.062 Mbp (822 bp) score=40
RTW15_010100010428 AraC family transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:2.065..2.066 Mbp (1.005 kbp) score=40
RTW15_010100010733 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:2.128..2.129 Mbp (618 bp) score=40
RTW15_010100011083 transcriptional regulator COG1414 Transcriptional regulator RTW15:2.218..2.219 Mbp (795 bp) score=40
RTW15_010100011163 HTH-type transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RTW15:2.237..2.238 Mbp (1.158 kbp) score=40
RTW15_010100011178 HTH-type transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RTW15:2.24..2.241 Mbp (933 bp) score=40
RTW15_010100011188 AraC family transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:2.244..2.245 Mbp (918 bp) score=40
RTW15_010100011213 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:2.25..2.251 Mbp (891 bp) score=40
RTW15_010100011308 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:2.27..2.27 Mbp (930 bp) score=40
RTW15_010100011353 XRE family transcriptional regulator COG1396 Predicted transcriptional regulators RTW15:2.277..2.278 Mbp (588 bp) score=40
RTW15_010100011423 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:2.295..2.296 Mbp (921 bp) score=40
RTW15_010100011433 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:2.298..2.299 Mbp (705 bp) score=40
RTW15_010100011513 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:2.316..2.316 Mbp (453 bp) score=40
RTW15_010100011583 transcriptional regulator, GntR family protein COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RTW15:2.331..2.333 Mbp (1.476 kbp) score=40
RTW15_010100012157 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:2.447..2.448 Mbp (942 bp) score=40
RTW15_010100012522 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:2.512..2.513 Mbp (468 bp) score=40
RTW15_010100012697 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:2.545..2.546 Mbp (906 bp) score=40
RTW15_010100012762 transcriptional regulator COG0583 Transcriptional regulator RTW15:2.561..2.562 Mbp (882 bp) score=40
RTW15_010100012997 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:2.612..2.613 Mbp (879 bp) score=40
RTW15_010100013102 transcriptional regulator BetI COG1309 Transcriptional regulator RTW15:2.635..2.635 Mbp (573 bp) score=40
RTW15_010100013387 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:2.69..2.691 Mbp (588 bp) score=40
nrdR transcriptional regulator NrdR COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains RTW15:2.706..2.706 Mbp (471 bp) score=40
RTW15_010100013527 ArsR family transcriptional regulator COG0640 Predicted transcriptional regulators RTW15:2.717..2.717 Mbp (321 bp) score=40
RTW15_010100014690 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:2.958..2.959 Mbp (1.104 kbp) score=40
RTW15_010100015110 HTH-type GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:3.029..3.03 Mbp (711 bp) score=40
RTW15_010100015205 putative transcriptional regulator COG3682 Predicted transcriptional regulator RTW15:3.048..3.049 Mbp (396 bp) score=40
RTW15_010100015400 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:3.091..3.092 Mbp (546 bp) score=40
RTW15_010100015465 LacI family transcriptional regulator COG1609 Transcriptional regulators RTW15:3.105..3.106 Mbp (1.02 kbp) score=40
RTW15_010100015505 transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:3.113..3.114 Mbp (1.017 kbp) score=40
RTW15_010100015575 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:3.124..3.124 Mbp (510 bp) score=40
RTW15_010100015585 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:3.126..3.126 Mbp (828 bp) score=40
RTW15_010100015630 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:3.137..3.138 Mbp (975 bp) score=40
RTW15_010100016049 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:3.21..3.21 Mbp (429 bp) score=40
RTW15_010100016144 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:3.223..3.223 Mbp (441 bp) score=40
RTW15_010100016264 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:3.248..3.248 Mbp (573 bp) score=40
RTW15_010100016654 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:3.328..3.329 Mbp (846 bp) score=40
RTW15_010100016729 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:3.343..3.343 Mbp (426 bp) score=40
RTW15_010100016764 GntR family transcriptional regulator COG2188 Transcriptional regulators RTW15:3.35..3.351 Mbp (732 bp) score=40
RTW15_010100016824 transcriptional regulator COG1733 Predicted transcriptional regulators RTW15:3.365..3.365 Mbp (354 bp) score=40
RTW15_010100016954 LacI family transcriptional regulator COG1609 Transcriptional regulators RTW15:3.388..3.389 Mbp (960 bp) score=40
RTW15_010100016999 transcriptional regulator COG1475 Predicted transcriptional regulators RTW15:3.398..3.399 Mbp (891 bp) score=40
RTW15_010100017004 transcriptional regulator COG1475 Predicted transcriptional regulators RTW15:3.399..3.4 Mbp (900 bp) score=40
RTW15_010100017079 transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:3.426..3.426 Mbp (246 bp) score=40
RTW15_010100017094 transcriptional regulator COG1396 Predicted transcriptional regulators RTW15:3.431..3.431 Mbp (555 bp) score=40
RTW15_010100017169 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:3.446..3.447 Mbp (933 bp) score=40
RTW15_010100017599 TetR family transcriptional regulator COG1309 Transcriptional regulator RTW15:3.526..3.526 Mbp (579 bp) score=40
RTW15_010100017864 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:3.575..3.575 Mbp (453 bp) score=40
RTW15_010100018039 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:3.614..3.614 Mbp (876 bp) score=40
RTW15_010100018799 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:3.777..3.777 Mbp (381 bp) score=40
RTW15_010100018804 anaerobic benzoate catabolism transcriptional regulator COG1396 Predicted transcriptional regulators RTW15:3.778..3.779 Mbp (897 bp) score=40
RTW15_010100019199 transcriptional regulator PetP COG1846 Transcriptional regulators RTW15:3.862..3.862 Mbp (513 bp) score=40
RTW15_010100019249 negative transcriptional regulator COG2808 Transcriptional regulator RTW15:3.869..3.87 Mbp (621 bp) score=40
RTW15_010100019404 LacI family transcriptional regulator COG1609 Transcriptional regulators RTW15:3.9..3.902 Mbp (1.056 kbp) score=40
RTW15_010100019484 TetR-family transcriptional regulator COG1309 Transcriptional regulator RTW15:3.914..3.914 Mbp (582 bp) score=40
RTW15_010100019519 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RTW15:3.919..3.92 Mbp (930 bp) score=40
RTW15_010100019589 XRE family transcriptional regulator COG1476 Predicted transcriptional regulators RTW15:3.93..3.93 Mbp (219 bp) score=40
RTW15_010100019604 ArsR family transcriptional regulator COG0640 Predicted transcriptional regulators RTW15:3.932..3.932 Mbp (339 bp) score=40
RTW15_010100019704 HTH-type LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:3.952..3.953 Mbp (858 bp) score=40
RTW15_010100019785 RpiR family transcriptional regulator COG1737 Transcriptional regulators RTW15:3.965..3.965 Mbp (936 bp) score=40
RTW15_010100019850 transcriptional regulator, putative COG1396 Predicted transcriptional regulators RTW15:3.974..3.975 Mbp (1.296 kbp) score=40
RTW15_010100019905 transcriptional regulator SoxR COG0640 Predicted transcriptional regulators RTW15:3.983..3.983 Mbp (342 bp) score=40
RTW15_010100019955 transcriptional regulator COG0583 Transcriptional regulator RTW15:3.993..3.994 Mbp (903 bp) score=40
RTW15_010100019995 XRE family transcriptional regulator COG1396 Predicted transcriptional regulators RTW15:4.002..4.002 Mbp (258 bp) score=40
RTW15_010100020180 HTH-type LacI family transcriptional regulator COG1609 Transcriptional regulators RTW15:4.045..4.046 Mbp (1.026 kbp) score=40
RTW15_010100020481 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:4.112..4.113 Mbp (756 bp) score=40
RTW15_010100020691 DeoR family transcriptional regulator COG1349 Transcriptional regulators of sugar metabolism RTW15:4.169..4.169 Mbp (774 bp) score=40
RTW15_010100020726 DeoR family transcriptional regulator COG1349 Transcriptional regulators of sugar metabolism RTW15:4.176..4.177 Mbp (846 bp) score=40
RTW15_010100020791 transcriptional regulator/arsenate reductase COG0640 Predicted transcriptional regulators RTW15:4.192..4.193 Mbp (762 bp) score=40
RTW15_010100020921 MarR family transcriptional regulator COG1846 Transcriptional regulators RTW15:4.217..4.217 Mbp (441 bp) score=40
RTW15_010100020931 IclR family transcriptional regulator COG1414 Transcriptional regulator RTW15:4.219..4.219 Mbp (786 bp) score=40
RTW15_010100020991 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:4.232..4.233 Mbp (876 bp) score=40
RTW15_010100021056 transcriptional regulator COG1309 Transcriptional regulator RTW15:4.245..4.245 Mbp (597 bp) score=40
RTW15_010100021101 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:4.254..4.255 Mbp (654 bp) score=40
RTW15_010100021241 GntR family transcriptional regulator COG1802 Transcriptional regulators RTW15:4.282..4.283 Mbp (573 bp) score=40
RTW15_010100021271 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:4.288..4.288 Mbp (453 bp) score=40
RTW15_010100021341 LysR family transcriptional regulator COG0583 Transcriptional regulator RTW15:4.299..4.3 Mbp (915 bp) score=40
RTW15_010100021391 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RTW15:4.309..4.309 Mbp (681 bp) score=40
RTW15_010100021576 AsnC family transcriptional regulator COG1522 Transcriptional regulators RTW15:4.344..4.345 Mbp (459 bp) score=40
RTW15_010100021941 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RTW15:4.407..4.407 Mbp (579 bp) score=40
RTW15_010100022250 AraC family transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RTW15:4.47..4.471 Mbp (1.071 kbp) score=40
RTW15_010100000640 transcription regulator protein COG1846 Transcriptional regulators RTW15:110.9..111.3 kbp (489 bp) score=30
RTW15_010100000915 DNA-binding transcriptional activator MhpR COG1414 Transcriptional regulator RTW15:170.4..171.2 kbp (807 bp) score=30
RTW15_010100002154 transcriptional regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:403.9..404.5 kbp (546 bp) score=30
RTW15_010100003156 two component transcriptional regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:613.6..614.4 kbp (714 bp) score=30
RTW15_010100003271 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:639.8..640.8 kbp (999 bp) score=30
RTW15_010100003621 two component transcriptional regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:711.2..712 kbp (738 bp) score=30
RTW15_010100003886 putative LysR family regulatory protein COG0583 Transcriptional regulator RTW15:753.6..754.5 kbp (915 bp) score=30
RTW15_010100005216 Crp/FNR family transcriptional regulator COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RTW15:1.014..1.015 Mbp (669 bp) score=30
RTW15_010100005371 regulatory protein ArsR COG0640 Predicted transcriptional regulators RTW15:1.049..1.049 Mbp (312 bp) score=30
RTW15_010100006421 C4-dicarboxylate transport transcriptional regulatory protein COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RTW15:1.271..1.272 Mbp (1.23 kbp) score=30
RTW15_010100006736 C4-dicarboxylate transport transcriptional regulatory protein DctD COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RTW15:1.335..1.337 Mbp (1.335 kbp) score=30
RTW15_010100007061 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:1.395..1.396 Mbp (1.032 kbp) score=30
RTW15_010100007241 two component transcriptional regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:1.427..1.428 Mbp (690 bp) score=30
RTW15_010100009281 two component transcriptional regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:1.828..1.829 Mbp (687 bp) score=30
RTW15_010100010808 two component transcriptional regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:2.149..2.15 Mbp (678 bp) score=30
RTW15_010100011383 LysR family transcriptional activator COG0583 Transcriptional regulator RTW15:2.286..2.287 Mbp (882 bp) score=30
RTW15_010100012447 leucine-responsive regulatory protein, putative COG1522 Transcriptional regulators RTW15:2.5..2.501 Mbp (501 bp) score=30
RTW15_010100012742 proline dehydrogenase transcriptional activator COG1522 Transcriptional regulators RTW15:2.556..2.557 Mbp (486 bp) score=30
RTW15_010100013307 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:2.675..2.676 Mbp (1.029 kbp) score=30
RTW15_010100014890 Transcriptional regulator, Crp/Fnr family protein COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RTW15:2.996..2.996 Mbp (735 bp) score=30
RTW15_010100014985 Transcriptional regulator, Crp/Fnr family protein COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RTW15:3.008..3.009 Mbp (753 bp) score=30
RTW15_010100015180 C4-dicarboxylate transport transcriptional regulatory protein DctD COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RTW15:3.041..3.043 Mbp (1.341 kbp) score=30
RTW15_010100015270 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:3.062..3.063 Mbp (888 bp) score=30
RTW15_010100015290 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:3.066..3.067 Mbp (1.059 kbp) score=30
RTW15_010100015515 transcriptional repressor COG1940 Transcriptional regulator/sugar kinase RTW15:3.114..3.115 Mbp (1.2 kbp) score=30
RTW15_010100016319 LuxR family transcriptional regulator COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RTW15:3.262..3.263 Mbp (762 bp) score=30
RTW15_010100016819 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:3.364..3.364 Mbp (903 bp) score=30
RTW15_010100017154 transcription regulator protein COG1846 Transcriptional regulators RTW15:3.444..3.445 Mbp (498 bp) score=30
RTW15_010100018814 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:3.78..3.781 Mbp (1.041 kbp) score=30
RTW15_010100020240 LacI family transcription regulator COG1609 Transcriptional regulators RTW15:4.06..4.061 Mbp (1.032 kbp) score=30
RTW15_010100020401 HTH-type LuxR family transcriptional regulator COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RTW15:4.098..4.098 Mbp (630 bp) score=30
RTW15_010100021791 redox-sensitive transcriptional activator SoxR COG0789 Predicted transcriptional regulators RTW15:4.381..4.382 Mbp (456 bp) score=30
RTW15_010100021836 DNA-binding transcriptional activator GcvA COG0583 Transcriptional regulator RTW15:4.389..4.39 Mbp (948 bp) score=30
RTW15_010100000400 periplasmic binding protein/LacI transcriptional regulator RTW15:65.77..66.76 kbp (996 bp) score=20
RTW15_010100000425 periplasmic binding protein/LacI transcriptional regulator RTW15:71.18..72.22 kbp (1.035 kbp) score=20
RTW15_010100000820 COG2378 Predicted transcriptional regulator RTW15:142..143 kbp (951 bp) score=20
RTW15_010100001245 lysine decarboxylase transcriptional regulator, CadC RTW15:240.3..241.5 kbp (1.173 kbp) score=20
RTW15_010100001575 COG2186 Transcriptional regulators RTW15:297.6..298.3 kbp (771 bp) score=20
RTW15_010100001580 COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RTW15:298.5..299.7 kbp (1.194 kbp) score=20
RTW15_010100001620 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:308.3..308.7 kbp (363 bp) score=20
RTW15_010100001835 DNA-binding response regulator ChvI COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:340.3..341 kbp (705 bp) score=20
RTW15_010100001999 COG1396 Predicted transcriptional regulators RTW15:368.8..369.5 kbp (657 bp) score=20
RTW15_010100002519 FUR family transcriptional regulator RTW15:485..485.5 kbp (417 bp) score=20
RTW15_010100003276 periplasmic binding protein/LacI transcriptional regulator RTW15:641..642 kbp (969 bp) score=20
RTW15_010100003721 putative DNA-binding transcriptional regulator RTW15:726.7..727.4 kbp (714 bp) score=20
RTW15_010100004171 COG1396 Predicted transcriptional regulators RTW15:813.9..814.5 kbp (558 bp) score=20
RTW15_010100004196 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII RTW15:818.3..818.7 kbp (339 bp) score=20
RTW15_010100004866 transcriptional regulator RTW15:954.5..955 kbp (501 bp) score=20
RTW15_010100004906 COG1396 Predicted transcriptional regulators RTW15:961.6..962 kbp (393 bp) score=20
RTW15_010100005491 Fis family two component sigma54 specific transcriptional regulator RTW15:1.073..1.074 Mbp (942 bp) score=20
RTW15_010100005936 COG1349 Transcriptional regulators of sugar metabolism RTW15:1.164..1.165 Mbp (762 bp) score=20
RTW15_010100006021 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:1.185..1.185 Mbp (681 bp) score=20
RTW15_010100006931 DNA-binding response regulator CtrA COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:1.371..1.371 Mbp (717 bp) score=20
RTW15_010100007096 TetR family transcriptional regulator RTW15:1.403..1.404 Mbp (420 bp) score=20
RTW15_010100007246 phosphate transport system regulatory protein PhoU COG0704 Phosphate uptake regulator RTW15:1.428..1.428 Mbp (702 bp) score=20
RTW15_010100007451 COG1959 Predicted transcriptional regulator RTW15:1.471..1.471 Mbp (459 bp) score=20
RTW15_010100008046 COG1396 Predicted transcriptional regulators RTW15:1.597..1.598 Mbp (624 bp) score=20
RTW15_010100008141 COG1396 Predicted transcriptional regulators RTW15:1.62..1.62 Mbp (588 bp) score=20
RTW15_010100008146 nitrogen assimilation regulatory protein NtrX COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RTW15:1.62..1.622 Mbp (1.41 kbp) score=20
RTW15_010100008331 COG2378 Predicted transcriptional regulator RTW15:1.654..1.655 Mbp (672 bp) score=20
RTW15_010100008406 COG1396 Predicted transcriptional regulators RTW15:1.668..1.669 Mbp (867 bp) score=20
RTW15_010100008556 FUR family transcriptional regulator RTW15:1.696..1.696 Mbp (414 bp) score=20
RTW15_010100008721 COG1386 Predicted transcriptional regulator containing the HTH domain RTW15:1.728..1.728 Mbp (651 bp) score=20
RTW15_010100008856 COG2188 Transcriptional regulators RTW15:1.749..1.75 Mbp (705 bp) score=20
RTW15_010100009046 COG2378 Predicted transcriptional regulator RTW15:1.783..1.784 Mbp (708 bp) score=20
RTW15_010100009381 COG1396 Predicted transcriptional regulators RTW15:1.846..1.847 Mbp (570 bp) score=20
RTW15_010100009451 COG2378 Predicted transcriptional regulator RTW15:1.859..1.86 Mbp (693 bp) score=20
RTW15_010100009551 COG0640 Predicted transcriptional regulators RTW15:1.879..1.88 Mbp (177 bp) score=20
RTW15_010100009671 transcriptional activator protein FnrL COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RTW15:1.902..1.903 Mbp (744 bp) score=20
RTW15_010100010196 COG1733 Predicted transcriptional regulators RTW15:2.008..2.009 Mbp (528 bp) score=20
RTW15_010100010423 COG1396 Predicted transcriptional regulators RTW15:2.064..2.065 Mbp (678 bp) score=20
RTW15_010100010928 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:2.183..2.183 Mbp (702 bp) score=20
RTW15_010100011208 COG1396 Predicted transcriptional regulators RTW15:2.249..2.25 Mbp (618 bp) score=20
RTW15_010100011648 COG1396 Predicted transcriptional regulators RTW15:2.343..2.344 Mbp (603 bp) score=20
RTW15_010100012132 COG1737 Transcriptional regulators RTW15:2.44..2.441 Mbp (888 bp) score=20
RTW15_010100012567 response regulator COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RTW15:2.525..2.526 Mbp (717 bp) score=20
RTW15_010100012727 COG1414 Transcriptional regulator RTW15:2.551..2.552 Mbp (822 bp) score=20
RTW15_010100012962 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD COG3023 Negative regulator of beta-lactamase expression RTW15:2.608..2.608 Mbp (672 bp) score=20
RTW15_010100013007 COG1396 Predicted transcriptional regulators RTW15:2.615..2.615 Mbp (372 bp) score=20
RTW15_010100013087 COG0583 Transcriptional regulator RTW15:2.632..2.633 Mbp (888 bp) score=20
RTW15_010100013122 COG1396 Predicted transcriptional regulators RTW15:2.639..2.64 Mbp (1.401 kbp) score=20
RTW15_010100013437 HTH-type AraC family transcriptional regulator RTW15:2.702..2.703 Mbp (1.026 kbp) score=20
RTW15_010100013852 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII RTW15:2.781..2.781 Mbp (339 bp) score=20
RTW15_010100013877 autoinducer-binding transcriptional regulator LuxR RTW15:2.787..2.787 Mbp (702 bp) score=20
RTW15_010100014267 COG1396 Predicted transcriptional regulators RTW15:2.861..2.862 Mbp (684 bp) score=20
ilvH acetolactate synthase 3 regulatory subunit COG0440 Acetolactate synthase, small (regulatory) subunit RTW15:2.862..2.863 Mbp (561 bp) score=20
RTW15_010100014297 LuxR family DNA-binding response regulator COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RTW15:2.867..2.867 Mbp (648 bp) score=20
RTW15_010100014680 LuxR family transcriptional regulator RTW15:2.956..2.956 Mbp (768 bp) score=20
RTW15_010100014795 LuxR family transcriptional regulator RTW15:2.974..2.975 Mbp (960 bp) score=20
RTW15_010100015000 LuxR family transcriptional regulator RTW15:3.009..3.01 Mbp (231 bp) score=20
RTW15_010100015015 CadC family transcriptional regulator RTW15:3.011..3.012 Mbp (1.176 kbp) score=20
RTW15_010100015035 transcriptional regulator, AraC family protein RTW15:3.013..3.014 Mbp (891 bp) score=20
RTW15_010100015075 COG1475 Predicted transcriptional regulators RTW15:3.021..3.022 Mbp (1.056 kbp) score=20
RTW15_010100015355 COG1940 Transcriptional regulator/sugar kinase RTW15:3.081..3.082 Mbp (1.218 kbp) score=20
RTW15_010100015520 periplasmic binding protein/LacI transcriptional regulator RTW15:3.115..3.116 Mbp (1.08 kbp) score=20
RTW15_010100015910 COG1959 Predicted transcriptional regulator RTW15:3.187..3.188 Mbp (447 bp) score=20
RTW15_010100016209 COG1396 Predicted transcriptional regulators RTW15:3.236..3.237 Mbp (564 bp) score=20
RTW15_010100016579 COG1522 Transcriptional regulators RTW15:3.319..3.319 Mbp (240 bp) score=20
RTW15_010100016919 COG1396 Predicted transcriptional regulators RTW15:3.382..3.383 Mbp (384 bp) score=20
RTW15_010100017109 COG0583 Transcriptional regulator RTW15:3.434..3.435 Mbp (930 bp) score=20
RTW15_010100017149 transcriptional regulator, AraC family protein RTW15:3.443..3.444 Mbp (891 bp) score=20
RTW15_010100017269 diguanylate cyclase, putative/response regulator COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain RTW15:3.462..3.464 Mbp (1.401 kbp) score=20
RTW15_010100017309 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RTW15:3.469..3.469 Mbp (780 bp) score=20
RTW15_010100017779 autoinducer-binding transcriptional regulator LuxR RTW15:3.56..3.561 Mbp (720 bp) score=20
hrcA COG1420 Transcriptional regulator of heat shock gene RTW15:3.695..3.697 Mbp (1.065 kbp) score=20
RTW15_010100018419 COG1475 Predicted transcriptional regulators RTW15:3.699..3.7 Mbp (894 bp) score=20
RTW15_010100018589 photosynthetic apparatus regulatory protein RegA COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain RTW15:3.734..3.734 Mbp (555 bp) score=20
RTW15_010100018704 DNA-binding response regulator, putative COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:3.755..3.756 Mbp (669 bp) score=20
RTW15_010100018719 response regulator protein COG4566 Response regulator RTW15:3.758..3.759 Mbp (618 bp) score=20
RTW15_010100019039 COG1522 Transcriptional regulators RTW15:3.831..3.832 Mbp (483 bp) score=20
RTW15_010100019044 COG1522 Transcriptional regulators RTW15:3.832..3.832 Mbp (450 bp) score=20
RTW15_010100019049 COG1522 Transcriptional regulators RTW15:3.832..3.833 Mbp (990 bp) score=20
RTW15_010100019194 DNA-binding response regulator PetR COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:3.861..3.862 Mbp (702 bp) score=20
RTW15_010100019209 AraC family transcriptional regulator RTW15:3.863..3.864 Mbp (951 bp) score=20
RTW15_010100019494 AraC family transcriptional regulator RTW15:3.916..3.917 Mbp (1.011 kbp) score=20
RTW15_010100019554 COG1475 Predicted transcriptional regulators RTW15:3.925..3.926 Mbp (249 bp) score=20
RTW15_010100019845 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:3.974..3.974 Mbp (381 bp) score=20
RTW15_010100019855 LuxR family transcriptional regulator RTW15:3.976..3.976 Mbp (537 bp) score=20
RTW15_010100021261 AraC family transcriptional regulator RTW15:4.286..4.287 Mbp (834 bp) score=20
RTW15_010100021701 COG1678 Putative transcriptional regulator RTW15:4.367..4.367 Mbp (458 bp) score=20
RTW15_010100022095 COG1475 Predicted transcriptional regulators RTW15:4.441..4.442 Mbp (969 bp) score=20
RTW15_010100022345 AraC family transcriptional regulator RTW15:4.49..4.491 Mbp (1.008 kbp) score=20
RTW15_010100000780 COG1765 Predicted redox protein, regulator of disulfide bond formation RTW15:134.6..135.1 kbp (456 bp) score=10
RTW15_010100002259 COG3327 Phenylacetic acid-responsive transcriptional repressor RTW15:424.5..425.3 kbp (804 bp) score=10
RTW15_010100003406 sensor histidine kinase/response regulator RTW15:666.8..669 kbp (2.214 kbp) score=10
RTW15_010100003826 ADA regulatory protein RTW15:741.9..742.7 kbp (852 bp) score=10
RTW15_010100004056 transcriptional activator ChrR RTW15:787.7..788.4 kbp (651 bp) score=10
RTW15_010100005481 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:1.07..1.071 Mbp (1.137 kbp) score=10
RTW15_010100006081 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RTW15:1.198..1.199 Mbp (579 bp) score=10
RTW15_010100006751 COG0425 Predicted redox protein, regulator of disulfide bond formation RTW15:1.34..1.34 Mbp (234 bp) score=10
RTW15_010100007191 ATP-dependent transcription regulator LuxR RTW15:1.417..1.418 Mbp (753 bp) score=10
RTW15_010100007516 sensory box sensor histidine kianse/response regulator RTW15:1.482..1.484 Mbp (2.307 kbp) score=10
RTW15_010100007631 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RTW15:1.507..1.508 Mbp (681 bp) score=10
RTW15_010100007841 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) RTW15:1.55..1.551 Mbp (699 bp) score=10
RTW15_010100007976 two-component hybrid sensor and regulator RTW15:1.581..1.583 Mbp (2.475 kbp) score=10
RTW15_010100007981 two-component hybrid sensor and regulator RTW15:1.583..1.585 Mbp (1.563 kbp) score=10
RTW15_010100007986 two-component response regulator RTW15:1.585..1.586 Mbp (468 bp) score=10
RTW15_010100008156 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RTW15:1.624..1.625 Mbp (1.368 kbp) score=10
flaF flagellar biosynthesis regulatory protein FlaF RTW15:1.798..1.798 Mbp (375 bp) score=10
RTW15_010100009141 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RTW15:1.801..1.802 Mbp (702 bp) score=10
RTW15_010100009356 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RTW15:1.843..1.844 Mbp (450 bp) score=10
RTW15_010100009361 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RTW15:1.844..1.844 Mbp (339 bp) score=10
RTW15_010100009486 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RTW15:1.864..1.866 Mbp (1.974 kbp) score=10
RTW15_010100010463 ferric uptake regulator family protein RTW15:2.073..2.073 Mbp (528 bp) score=10
RTW15_010100010933 sensory box histidine kinase/response regulator RTW15:2.183..2.185 Mbp (1.902 kbp) score=10
RTW15_010100011493 COG1765 Predicted redox protein, regulator of disulfide bond formation RTW15:2.312..2.313 Mbp (405 bp) score=10
RTW15_010100011682 COG3279 Response regulator of the LytR/AlgR family RTW15:2.35..2.351 Mbp (738 bp) score=10
RTW15_010100011767 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RTW15:2.366..2.367 Mbp (867 bp) score=10
RTW15_010100012012 GcrA cell cycle regulator RTW15:2.418..2.419 Mbp (570 bp) score=10
RTW15_010100013882 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RTW15:2.788..2.788 Mbp (486 bp) score=10
RTW15_010100016044 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RTW15:3.209..3.209 Mbp (678 bp) score=10
RTW15_010100016094 PTS IIA-like nitrogen-regulatory protein PtsN RTW15:3.216..3.217 Mbp (465 bp) score=10
RTW15_010100018339 response regulator RTW15:3.683..3.684 Mbp (1.275 kbp) score=10
RTW15_010100018584 regulatory protein SenC RTW15:3.733..3.734 Mbp (618 bp) score=10
RTW15_010100019009 nitrous-oxide reductase transcriptional activator NosR RTW15:3.826..3.828 Mbp (2.178 kbp) score=10
RTW15_010100019129 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RTW15:3.85..3.85 Mbp (702 bp) score=10
hisZ ATP phosphoribosyltransferase regulatory subunit RTW15:4.006..4.007 Mbp (1.089 kbp) score=10
RTW15_010100020155 response regulator receiver protein RTW15:4.038..4.038 Mbp (387 bp) score=10
RTW15_010100020160 two-component hybrid sensor and regulator RTW15:4.038..4.042 Mbp (3.585 kbp) score=10
RTW15_010100020320 COG0641 Arylsulfatase regulator (Fe-S oxidoreductase) RTW15:4.077..4.079 Mbp (1.311 kbp) score=10
RTW15_010100021096 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RTW15:4.253..4.254 Mbp (501 bp) score=10
RTW15_010100021221 response regulator receiver protein RTW15:4.279..4.28 Mbp (948 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70