Roseobase: Roseovarius sp. TM1035

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RTM1035:300000..400000, RTM1035_20596, fliN, ZP_01881613, RTM1035_t18891, RTM1035_r20596, translation initiation factor, ATRGSEGWSGNFTALNA AVEAQMAARNDLIQGVQTLYTNVKAEVDAFLAVLVDI.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 95 regions match your request.
Matches on RTM1035
overview_RTM1035
RTM1035_02445 translation initiation factor IF-1 COG0361 Translation initiation factor 1 (IF-1) RTM1035:516.5..516.7 kbp (219 bp) score=60
RTM1035_07163 elongation factor P COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) RTM1035:1.467..1.468 Mbp (564 bp) score=60
RTM1035_09404 translation initiation factor IF-3 COG0290 Translation initiation factor 3 (IF-3) RTM1035:1.927..1.927 Mbp (630 bp) score=60
fliN translation initiation factor IF-2 COG0532 Translation initiation factor 2 (IF-2; GTPase) RTM1035:3.947..3.949 Mbp (2.442 kbp) score=60
RTM1035_02785 translation elongation factor G COG0480 Translation elongation factors (GTPases) RTM1035:587.4..589.5 kbp (2.124 kbp) score=40
RTM1035_03210 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB RTM1035:656.6..657 kbp (390 bp) score=40
RTM1035_06323 translation elongation factor Tu COG0050 GTPases - translation elongation factors RTM1035:1.288..1.29 Mbp (1.176 kbp) score=40
RTM1035_15547 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB RTM1035:3.155..3.155 Mbp (300 bp) score=40
infA translation initiation factor IF-1 RTM1035:516.3..516.5 kbp (192 bp) score=30
tuf elongation factor Tu COG0050 GTPases - translation elongation factors RTM1035:589.6..590.8 kbp (1.176 kbp) score=30
RTM1035_03135 anti-anti-sigma factor COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RTM1035:643..643.4 kbp (339 bp) score=30
RTM1035_07213 translation-associated GTPase COG0012 Predicted GTPase, probable translation factor RTM1035:1.478..1.479 Mbp (1.098 kbp) score=30
tsf elongation factor Ts COG0264 Translation elongation factor Ts RTM1035:1.693..1.694 Mbp (873 bp) score=30
infC translation initiation factor IF-3 RTM1035:1.926..1.927 Mbp (813 bp) score=30
RTM1035_17412 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RTM1035:3.529..3.529 Mbp (684 bp) score=30
RTM1035_00775 Cytochrome c biogenesis factor COG1138 Cytochrome c biogenesis factor RTM1035:153.3..155.3 kbp (1.992 kbp) score=20
RTM1035_00950 anti-sigm factor, ChrR COG3806 Anti-sigma factor RTM1035:194.8..195.5 kbp (669 bp) score=20
rbfA ribosome-binding factor A COG0858 Ribosome-binding factor A RTM1035:575.7..576.1 kbp (405 bp) score=20
RTM1035_03130 anti-sigma B factor, putative COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RTM1035:642.5..643 kbp (501 bp) score=20
RTM1035_03825 COG0251 Putative translation initiation inhibitor, yjgF family RTM1035:773.7..774.2 kbp (462 bp) score=20
RTM1035_04295 COG0251 Putative translation initiation inhibitor, yjgF family RTM1035:868.8..869.2 kbp (399 bp) score=20
RTM1035_05300 ECF-family sigma factor COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain RTM1035:1.072..1.073 Mbp (1.236 kbp) score=20
RTM1035_06578 molybdenum cofactor biosynthesis protein C COG0315 Molybdenum cofactor biosynthesis enzyme RTM1035:1.344..1.344 Mbp (477 bp) score=20
RTM1035_09034 peptide chain release factor 2 COG1186 Protein chain release factor B RTM1035:1.852..1.853 Mbp (1.128 kbp) score=20
tig trigger factor COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) RTM1035:2.155..2.156 Mbp (1.332 kbp) score=20
RTM1035_10650 peptide chain release factor 3 COG4108 Peptide chain release factor RF-3 RTM1035:2.181..2.182 Mbp (1.608 kbp) score=20
RTM1035_10940 transcription-repair coupling factor COG1197 Transcription-repair coupling factor (superfamily II helicase) RTM1035:2.237..2.24 Mbp (3.453 kbp) score=20
RTM1035_11030 peptide chain release factor 1 COG0216 Protein chain release factor A RTM1035:2.259..2.26 Mbp (1.254 kbp) score=20
RTM1035_11130 Anti-sigma factor ChrR COG3806 Anti-sigma factor RTM1035:2.275..2.276 Mbp (651 bp) score=20
RTM1035_11500 hydrogenase maturation factor F COG0068 Hydrogenase maturation factor RTM1035:2.349..2.351 Mbp (2.214 kbp) score=20
moaA molybdenum cofactor biosynthesis protein A COG2896 Molybdenum cofactor biosynthesis enzyme RTM1035:2.367..2.368 Mbp (915 bp) score=20
RTM1035_11845 COG0009 Putative translation factor (SUA5) RTM1035:2.423..2.424 Mbp (948 bp) score=20
RTM1035_12493 ribosome recycling factor COG0233 Ribosome recycling factor RTM1035:2.555..2.556 Mbp (564 bp) score=20
RTM1035_13488 transcription antitermination factor NusB COG0781 Transcription termination factor RTM1035:2.744..2.744 Mbp (483 bp) score=20
RTM1035_16532 COG0251 Putative translation initiation inhibitor, yjgF family RTM1035:3.36..3.361 Mbp (432 bp) score=20
rho transcription termination factor Rho COG1158 Transcription termination factor RTM1035:3.77..3.771 Mbp (1.257 kbp) score=20
dnaA chromosomal replication initiation protein COG0593 ATPase involved in DNA replication initiation RTM1035:3.933..3.934 Mbp (1.347 kbp) score=20
RTM1035_19441 transcription elongation factor NusA COG0195 Transcription elongation factor RTM1035:3.944..3.946 Mbp (1.623 kbp) score=20
RTM1035_19541 transcription elongation factor GreA COG0782 Transcription elongation factor RTM1035:3.969..3.97 Mbp (471 bp) score=20
RTM1035_20036 molybdopterin converting factor, subunit 1 COG1977 Molybdopterin converting factor, small subunit RTM1035:4.094..4.094 Mbp (249 bp) score=20
RTM1035_20041 molybdopterin converting factor, subunit 2 COG0314 Molybdopterin converting factor, large subunit RTM1035:4.094..4.095 Mbp (444 bp) score=20
RTM1035_00365 RNA polymerase sigma-70 factor, ECF subfamily protein RTM1035:69.73..70.35 kbp (627 bp) score=10
RTM1035_00375 RNA polymerase sigma-70 factor, ECF subfamily protein RTM1035:71.72..72.39 kbp (669 bp) score=10
RTM1035_00760 COG4235 Cytochrome c biogenesis factor RTM1035:151.1..152.2 kbp (1.152 kbp) score=10
RTM1035_02515 COG0728 Uncharacterized membrane protein, putative virulence factor RTM1035:536..537.5 kbp (1.539 kbp) score=10
tuf elongation factor Tu RTM1035:589.6..590.8 kbp (1.176 kbp) score=10
RTM1035_03058 RNA polymerase sigma factor RTM1035:627.9..628.1 kbp (171 bp) score=10
RTM1035_03465 putative RpoE6 RNA polymerase sigma factor RTM1035:704.9..705.4 kbp (507 bp) score=10
RTM1035_03770 sigma factor FliA (Sigma-28 group, flagellar) RTM1035:764.1..764.9 kbp (729 bp) score=10
RTM1035_03800 COG2747 Negative regulator of flagellin synthesis (anti-sigma28 factor) RTM1035:770.6..770.9 kbp (303 bp) score=10
RTM1035_04310 chromosome replication initiation inhibitor protein RTM1035:871.4..872.3 kbp (915 bp) score=10
RTM1035_04975 COG5271 AAA ATPase containing von Willebrand factor type A (vWA) domain RTM1035:1.02..1.021 Mbp (987 bp) score=10
RTM1035_06348 transcription termination/antitermination factor NusG RTM1035:1.295..1.295 Mbp (534 bp) score=10
RTM1035_06573 molybdenum cofactor biosynthesis protein A RTM1035:1.342..1.344 Mbp (1.173 kbp) score=10
RTM1035_06683 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase RTM1035:1.365..1.367 Mbp (2.166 kbp) score=10
RTM1035_06688 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase RTM1035:1.367..1.367 Mbp (252 bp) score=10
RTM1035_07053 Putative transmembrane anti-sigma factor RTM1035:1.442..1.443 Mbp (768 bp) score=10
RTM1035_07058 RNA polymerase sigma factor RTM1035:1.443..1.443 Mbp (543 bp) score=10
RTM1035_07268 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation RTM1035:1.489..1.491 Mbp (1.377 kbp) score=10
RTM1035_07544 COG1977 Molybdopterin converting factor, small subunit RTM1035:1.548..1.548 Mbp (246 bp) score=10
RTM1035_07784 COG0593 ATPase involved in DNA replication initiation RTM1035:1.596..1.597 Mbp (1.203 kbp) score=10
RTM1035_07919 COG0728 Uncharacterized membrane protein, putative virulence factor RTM1035:1.627..1.628 Mbp (1.509 kbp) score=10
RTM1035_08439 iron-sulfur cluster assembly transcription factor IscR, putative RTM1035:1.732..1.733 Mbp (462 bp) score=10
RTM1035_08884 integration host factor, alpha subunit RTM1035:1.822..1.822 Mbp (303 bp) score=10
RTM1035_09848 probable aggregation factor core protein MAFp3, isoform C RTM1035:2.015..2.019 Mbp (3.993 kbp) score=10
hfq COG1923 Uncharacterized host factor I protein RTM1035:2.041..2.042 Mbp (240 bp) score=10
RTM1035_09970 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RTM1035:2.047..2.048 Mbp (771 bp) score=10
RTM1035_10135 COG1138 Cytochrome c biogenesis factor RTM1035:2.086..2.088 Mbp (2.058 kbp) score=10
RTM1035_10210 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RTM1035:2.104..2.105 Mbp (972 bp) score=10
RTM1035_10215 COG3552 Protein containing von Willebrand factor type A (vWA) domain RTM1035:2.105..2.106 Mbp (1.263 kbp) score=10
ihfB integration host factor subunit beta RTM1035:2.227..2.227 Mbp (282 bp) score=10
RTM1035_11025 COG2890 Methylase of polypeptide chain release factors RTM1035:2.258..2.259 Mbp (858 bp) score=10
RTM1035_11125 RNA polymerase sigma factor RpoE RTM1035:2.275..2.275 Mbp (657 bp) score=10
RTM1035_11395 antisigma-factor antagonist, STAS RTM1035:2.33..2.331 Mbp (1.491 kbp) score=10
RTM1035_11415 COG0309 Hydrogenase maturation factor RTM1035:2.336..2.337 Mbp (1.116 kbp) score=10
RTM1035_11420 COG0409 Hydrogenase maturation factor RTM1035:2.337..2.338 Mbp (1.143 kbp) score=10
RTM1035_11425 COG0298 Hydrogenase maturation factor RTM1035:2.338..2.338 Mbp (291 bp) score=10
RTM1035_11465 COG0298 Hydrogenase maturation factor RTM1035:2.344..2.344 Mbp (321 bp) score=10
RTM1035_11470 COG0680 Ni,Fe-hydrogenase maturation factor RTM1035:2.344..2.345 Mbp (609 bp) score=10
RTM1035_12353 RNA polymerase sigma factor RpoD RTM1035:2.526..2.527 Mbp (1.986 kbp) score=10
RTM1035_12393 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain RTM1035:2.537..2.539 Mbp (1.755 kbp) score=10
RTM1035_12533 COG3552 Protein containing von Willebrand factor type A (vWA) domain RTM1035:2.562..2.563 Mbp (1.182 kbp) score=10
RTM1035_12538 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RTM1035:2.563..2.564 Mbp (768 bp) score=10
RTM1035_12918 COG0593 ATPase involved in DNA replication initiation RTM1035:2.638..2.638 Mbp (678 bp) score=10
RTM1035_13338 RNA polymerase sigma factor RTM1035:2.717..2.718 Mbp (897 bp) score=10
RTM1035_13408 von Willebrand factor, type A RTM1035:2.73..2.732 Mbp (2.244 kbp) score=10
RTM1035_13723 molybdenum cofactor biosynthesis domain protein RTM1035:2.793..2.793 Mbp (723 bp) score=10
rpoH2 RNA polymerase sigma-32 factor RTM1035:2.816..2.817 Mbp (834 bp) score=10
RTM1035_14452 COG3175 Cytochrome oxidase assembly factor RTM1035:2.934..2.934 Mbp (582 bp) score=10
RTM1035_14462 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) RTM1035:2.934..2.935 Mbp (957 bp) score=10
RTM1035_15117 molybdenum cofactor biosynthesis protein B RTM1035:3.064..3.064 Mbp (543 bp) score=10
RTM1035_16127 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RTM1035:3.285..3.286 Mbp (924 bp) score=10
RTM1035_16932 COG1186 Protein chain release factor B RTM1035:3.435..3.435 Mbp (447 bp) score=10
RTM1035_19001 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain RTM1035:3.858..3.858 Mbp (639 bp) score=10
RTM1035_19871 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) RTM1035:4.06..4.06 Mbp (885 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70