Roseobase: Roseobacter sp. SK209-2-6

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RSK20926:2300000..2400000, RSK20926_21534, ZP_01755139, aspS, RSK20926_t21469, RSK20926_r00948, Translation initiation factor, AAAAAPQSQDLAP AEPEAVEQEPQAEFAPAPEVAGPAEPEQMRMDLDSPQPQ.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 93 regions match your request.
Matches on RSK20926
overview_RSK20926
infA translation initiation factor IF-1 COG0361 Translation initiation factor 1 (IF-1) RSK20926:1.306..1.307 Mbp (219 bp) score=60
RSK20926_08297 translation initiation factor IF-2 COG0532 Translation initiation factor 2 (IF-2; GTPase) RSK20926:1.671..1.673 Mbp (2.493 kbp) score=60
RSK20926_14841 elongation factor P COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) RSK20926:2.949..2.95 Mbp (564 bp) score=60
infC translation initiation factor IF-3 COG0290 Translation initiation factor 3 (IF-3) RSK20926:3.318..3.318 Mbp (603 bp) score=60
RSK20926_19012 translation initiation factor IF-2B subunit alpha COG0182 Predicted translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family RSK20926:3.803..3.804 Mbp (1.092 kbp) score=60
RSK20926_02984 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB RSK20926:632.2..632.7 kbp (510 bp) score=40
RSK20926_05552 translation elongation factor Tu COG0050 GTPases - translation elongation factors RSK20926:1.141..1.142 Mbp (1.176 kbp) score=40
RSK20926_05937 translation elongation factor G, putative COG0480 Translation elongation factors (GTPases) RSK20926:1.21..1.211 Mbp (1.911 kbp) score=40
RSK20926_12094 translation elongation factor G COG0480 Translation elongation factors (GTPases) RSK20926:2.392..2.394 Mbp (2.118 kbp) score=40
RSK20926_12099 translation elongation factor Tu COG0050 GTPases - translation elongation factors RSK20926:2.394..2.395 Mbp (1.176 kbp) score=40
RSK20926_22239 translation initiation inhibitor COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:4.448..4.448 Mbp (387 bp) score=40
RSK20926_00005 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RSK20926:1..411 bp (411 bp) score=30
RSK20926_00957 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RSK20926:213.1..213.9 kbp (768 bp) score=30
fliN translation initiation factor IF-2 RSK20926:1.67..1.67 Mbp (135 bp) score=30
RSK20926_08692 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RSK20926:1.75..1.75 Mbp (696 bp) score=30
RSK20926_09604 anti-anti-sigma factor COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RSK20926:1.936..1.937 Mbp (339 bp) score=30
tsf elongation factor Ts COG0264 Translation elongation factor Ts RSK20926:3.781..3.782 Mbp (876 bp) score=30
RSK20926_00350 Plasmid replication initiation protein COG5527 Protein involved in initiation of plasmid replication RSK20926:84.27..85.54 kbp (1.269 kbp) score=20
RSK20926_01917 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:431.5..431.9 kbp (417 bp) score=20
RSK20926_02484 transcription antitermination factor NusB COG0781 Transcription termination factor RSK20926:536.4..536.9 kbp (483 bp) score=20
RSK20926_03374 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:709.9..710.2 kbp (339 bp) score=20
RSK20926_04042 von Willebrand factor type A domain protein COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain RSK20926:846.1..846.8 kbp (744 bp) score=20
RSK20926_04287 transcription elongation factor GreA COG0782 Transcription elongation factor RSK20926:891.4..891.9 kbp (471 bp) score=20
RSK20926_04372 COG0009 Putative translation factor (SUA5) RSK20926:904.7..905.7 kbp (975 bp) score=20
RSK20926_04527 molybdopterin converting factor, subunit 2 COG0314 Molybdopterin converting factor, large subunit RSK20926:931.1..931.5 kbp (447 bp) score=20
RSK20926_04532 putative molybdopterin MPT converting factor, subunit 1 protein COG1977 Molybdopterin converting factor, small subunit RSK20926:931.6..931.8 kbp (249 bp) score=20
RSK20926_05317 COG0012 Predicted GTPase, probable translation factor RSK20926:1.111..1.112 Mbp (1.098 kbp) score=20
RSK20926_08157 COG0480 Translation elongation factors (GTPases) RSK20926:1.643..1.644 Mbp (579 bp) score=20
RSK20926_08307 transcription elongation factor NusA COG0195 Transcription elongation factor RSK20926:1.674..1.675 Mbp (1.62 kbp) score=20
rho transcription termination factor Rho COG1158 Transcription termination factor RSK20926:1.728..1.729 Mbp (1.272 kbp) score=20
RSK20926_08792 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:1.768..1.769 Mbp (447 bp) score=20
dnaA chromosomal replication initiation protein COG0593 ATPase involved in DNA replication initiation RSK20926:1.847..1.849 Mbp (1.47 kbp) score=20
RSK20926_09599 anti-sigma B factor, putative COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RSK20926:1.936..1.936 Mbp (435 bp) score=20
RSK20926_09859 ribosome-binding factor A COG0858 Ribosome-binding factor A RSK20926:1.986..1.986 Mbp (396 bp) score=20
RSK20926_10169 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:2.045..2.045 Mbp (459 bp) score=20
RSK20926_12129 putative peptide chain release factor COG1186 Protein chain release factor B RSK20926:2.4..2.401 Mbp (642 bp) score=20
RSK20926_13139 xanthine dehydrogenase accessory factor COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RSK20926:2.601..2.601 Mbp (945 bp) score=20
RSK20926_13519 von Willebrand factor type A domain protein COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain RSK20926:2.687..2.689 Mbp (1.44 kbp) score=20
RSK20926_16172 molybdenum cofactor biosynthesis protein A COG2896 Molybdenum cofactor biosynthesis enzyme RSK20926:3.226..3.227 Mbp (1.023 kbp) score=20
RSK20926_16382 peptide chain release factor 3 COG4108 Peptide chain release factor RF-3 RSK20926:3.267..3.269 Mbp (1.608 kbp) score=20
RSK20926_17447 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:3.485..3.485 Mbp (378 bp) score=20
RSK20926_17597 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:3.51..3.511 Mbp (441 bp) score=20
RSK20926_18317 ribosome recycling factor COG0233 Ribosome recycling factor RSK20926:3.663..3.664 Mbp (612 bp) score=20
RSK20926_18687 transcription-repair coupling factor COG1197 Transcription-repair coupling factor (superfamily II helicase) RSK20926:3.736..3.74 Mbp (3.477 kbp) score=20
RSK20926_19637 molybdenum cofactor biosynthesis protein C COG0315 Molybdenum cofactor biosynthesis enzyme RSK20926:3.926..3.927 Mbp (474 bp) score=20
RSK20926_20157 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:4.035..4.035 Mbp (552 bp) score=20
tig trigger factor COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) RSK20926:4.147..4.148 Mbp (1.332 kbp) score=20
RSK20926_20865 peptide chain release factor 1 COG0216 Protein chain release factor A RSK20926:4.178..4.179 Mbp (1.056 kbp) score=20
RSK20926_21345 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:4.268..4.269 Mbp (306 bp) score=20
RSK20926_21350 COG0251 Putative translation initiation inhibitor, yjgF family RSK20926:4.269..4.269 Mbp (363 bp) score=20
RSK20926_21999 peptide chain release factor 2 COG1186 Protein chain release factor B RSK20926:4.395..4.397 Mbp (1.125 kbp) score=20
RSK20926_01412 COG0593 ATPase involved in DNA replication initiation RSK20926:310.5..311.1 kbp (645 bp) score=10
RSK20926_02404 RNA polymerase sigma factor RSK20926:526.4..526.6 kbp (150 bp) score=10
RSK20926_02409 RNA polymerase sigma factor RSK20926:526.9..527.8 kbp (897 bp) score=10
RSK20926_02574 RNA polymerase sigma factor RpoD RSK20926:551.2..553.2 kbp (1.992 kbp) score=10
RSK20926_02734 RNA polymerase sigma factor RSK20926:583.4..584 kbp (597 bp) score=10
RSK20926_04402 molybdenum cofactor biosynthesis protein B RSK20926:913..913.5 kbp (543 bp) score=10
RSK20926_06617 COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 RSK20926:1.338..1.339 Mbp (1.029 kbp) score=10
RSK20926_07507 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) RSK20926:1.504..1.504 Mbp (891 bp) score=10
RSK20926_07588 COG1186 Protein chain release factor B RSK20926:1.528..1.528 Mbp (420 bp) score=10
RSK20926_08317 COG5662 Predicted transmembrane transcriptional regulator (anti-sigma factor) RSK20926:1.676..1.677 Mbp (750 bp) score=10
RSK20926_08322 RNA polymerase sigma factor protein (sigma-24) RSK20926:1.677..1.677 Mbp (438 bp) score=10
RSK20926_10229 molybdenum cofactor biosynthesis domain protein RSK20926:2.055..2.055 Mbp (780 bp) score=10
RSK20926_10899 RNA polymerase sigma-70 factor, ECF family protein RSK20926:2.187..2.188 Mbp (876 bp) score=10
ihfB integration host factor subunit beta RSK20926:2.21..2.211 Mbp (285 bp) score=10
RSK20926_11939 transcription termination/antitermination factor NusG RSK20926:2.363..2.363 Mbp (534 bp) score=10
RSK20926_12079 COG1158 Transcription termination factor RSK20926:2.39..2.391 Mbp (807 bp) score=10
RSK20926_12294 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase RSK20926:2.43..2.432 Mbp (2.196 kbp) score=10
RSK20926_12569 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) RSK20926:2.486..2.487 Mbp (945 bp) score=10
RSK20926_12579 COG3175 Cytochrome oxidase assembly factor RSK20926:2.487..2.488 Mbp (588 bp) score=10
RSK20926_12919 COG3806 Anti-sigma factor RSK20926:2.55..2.551 Mbp (675 bp) score=10
RSK20926_16357 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RSK20926:3.261..3.262 Mbp (783 bp) score=10
RSK20926_16437 RNA polymerase sigma factor SigZ RSK20926:3.278..3.278 Mbp (288 bp) score=10
RSK20926_16442 RNA polymerase sigma-70 factor RSK20926:3.278..3.279 Mbp (543 bp) score=10
RSK20926_16602 COG3552 Protein containing von Willebrand factor type A (vWA) domain RSK20926:3.309..3.31 Mbp (1.251 kbp) score=10
RSK20926_16612 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RSK20926:3.311..3.312 Mbp (984 bp) score=10
RSK20926_18652 COG1923 Uncharacterized host factor I protein RSK20926:3.728..3.729 Mbp (240 bp) score=10
RSK20926_19172 iron-sulfur cluster assembly transcription factor IscR, putative RSK20926:3.829..3.83 Mbp (462 bp) score=10
RSK20926_19642 molybdenum cofactor biosynthesis protein A RSK20926:3.927..3.928 Mbp (1.173 kbp) score=10
RSK20926_19687 COG1138 Cytochrome c biogenesis factor RSK20926:3.937..3.939 Mbp (1.959 kbp) score=10
RSK20926_20860 COG2890 Methylase of polypeptide chain release factors RSK20926:4.177..4.178 Mbp (864 bp) score=10
RSK20926_21050 integration host factor, alpha subunit RSK20926:4.21..4.21 Mbp (303 bp) score=10
RSK20926_21609 COG4235 Cytochrome c biogenesis factor RSK20926:4.325..4.326 Mbp (1.29 kbp) score=10
RSK20926_21799 COG3806 Anti-sigma factor RSK20926:4.353..4.353 Mbp (636 bp) score=10
RSK20926_21804 RNA polymerase sigma factor RpoE RSK20926:4.353..4.354 Mbp (630 bp) score=10
RSK20926_21854 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RSK20926:4.365..4.366 Mbp (978 bp) score=10
RSK20926_21869 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RSK20926:4.368..4.368 Mbp (780 bp) score=10
RSK20926_21874 COG3552 Protein containing von Willebrand factor type A (vWA) domain RSK20926:4.368..4.37 Mbp (1.131 kbp) score=10
rpoH2 RNA polymerase sigma-32 factor RSK20926:4.428..4.429 Mbp (879 bp) score=10
RSK20926_22194 COG0728 Uncharacterized membrane protein, putative virulence factor RSK20926:4.439..4.441 Mbp (1.59 kbp) score=10
RSK20926_22364 COG0593 ATPase involved in DNA replication initiation RSK20926:4.47..4.471 Mbp (708 bp) score=10
RSK20926_22539 chromosome replication initiation inhibitor protein RSK20926:4.503..4.503 Mbp (372 bp) score=10
RSK20926_22544 chromosome replication initiation inhibitor protein RSK20926:4.503..4.504 Mbp (525 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70