Roseobase: Ruegeria sp. R11

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RR11:300000..400000, RR11_3056, aidB, ZP_05091274, translation initiation factor, MSAVSTQQVNRLSGGLVDRGQPLSFRFDGQSYQGCSGDTLASALMANGVRLMGRSFKY.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 75 regions match your request.
Matches on RR11
overview_RR11
efp translation elongation factor P [J] COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) RR11:370.9..371.5 kbp (564 bp) score=70
infC translation initiation factor IF-3 [J] COG0290 Translation initiation factor 3 (IF-3) RR11:598.5..598.9 kbp (435 bp) score=60
infB translation initiation factor IF-2 [J] COG0532 Translation initiation factor 2 (IF-2; GTPase) RR11:3.004..3.007 Mbp (2.481 kbp) score=60
infA translation initiation factor IF-1 [J] COG0361 Translation initiation factor 1 (IF-1) RR11:3.228..3.228 Mbp (219 bp) score=60
tsf translation elongation factor Ts [J] COG0264 Translation elongation factor Ts RR11:1.164..1.165 Mbp (876 bp) score=40
tuf_1 translation elongation factor Tu [J] COG3276 Selenocysteine-specific translation elongation factor RR11:3.333..3.334 Mbp (1.176 kbp) score=40
fusA_2 translation elongation factor G [J] COG0480 Translation elongation factors (GTPases) RR11:3.355..3.357 Mbp (2.121 kbp) score=40
tuf_2 translation elongation factor Tu [J] COG3276 Selenocysteine-specific translation elongation factor RR11:3.357..3.359 Mbp (1.176 kbp) score=40
RR11_63 anti-sigma-factor antagonist [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RR11:171.4..172.3 kbp (876 bp) score=30
RR11_1773 [J] COG0532 Translation initiation factor 2 (IF-2; GTPase) RR11:430.8..431.5 kbp (723 bp) score=30
RR11_212 [J] COG0532 Translation initiation factor 2 (IF-2; GTPase) RR11:692.9..693.5 kbp (663 bp) score=30
mtnA [J] COG1184 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family RR11:1.103..1.104 Mbp (1.098 kbp) score=30
RR11_3261 [MJ] COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RR11:1.417..1.419 Mbp (1.494 kbp) score=30
glmU [MJ] COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RR11:1.72..1.721 Mbp (1.356 kbp) score=30
RR11_686 anti-sigma-factor antagonist [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RR11:2.748..2.748 Mbp (345 bp) score=30
galU [MJ] COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RR11:3.023..3.024 Mbp (894 bp) score=30
fusA_1 elongation factor G protein [J] COG0480 Translation elongation factors (GTPases) RR11:3.269..3.271 Mbp (1.899 kbp) score=30
rfbF [MJ] COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) RR11:3.677..3.678 Mbp (768 bp) score=30
RR11_54 [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RR11:171..171.4 kbp (363 bp) score=20
prfB peptide chain release factor 2 [J] COG1186 Protein chain release factor B RR11:659.4..660.5 kbp (1.125 kbp) score=20
prfA peptide chain release factor 1 [J] COG1186 Protein chain release factor B RR11:690.7..691.8 kbp (1.056 kbp) score=20
RR11_1557 [J] COG0251 Putative translation initiation inhibitor, yjgF family RR11:887.7..888.8 kbp (1.068 kbp) score=20
tig trigger factor [O] COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) RR11:901.7..903 kbp (1.335 kbp) score=20
frr ribosome recycling factor [J] COG0233 Ribosome recycling factor RR11:1.309..1.309 Mbp (564 bp) score=20
RR11_1874 [J] COG0251 Putative translation initiation inhibitor, yjgF family RR11:1.456..1.457 Mbp (396 bp) score=20
RR11_1681 [J] COG0251 Putative translation initiation inhibitor, yjgF family RR11:1.478..1.478 Mbp (396 bp) score=20
nusB transcription antitermination factor NusB [K] COG0781 Transcription termination factor RR11:1.855..1.855 Mbp (492 bp) score=20
RR11_860 [J] COG0251 Putative translation initiation inhibitor, yjgF family RR11:2.132..2.132 Mbp (351 bp) score=20
RR11_2305 anti-ECFsigma factor, ChrR [T] COG3806 Anti-sigma factor RR11:2.18..2.181 Mbp (669 bp) score=20
RR11_2285 transcription elongation factor GreA [K] COG0782 Transcription elongation factor RR11:2.557..2.557 Mbp (471 bp) score=20
moaE molybdopterin converting factor, subunit 2 [H] COG0314 Molybdopterin converting factor, large subunit RR11:2.591..2.591 Mbp (462 bp) score=20
moaD molybdopterin converting factor, subunit 1 [H] COG1977 Molybdopterin converting factor, small subunit RR11:2.591..2.591 Mbp (246 bp) score=20
rbfA ribosome-binding factor A [J] COG0858 Ribosome-binding factor A RR11:2.721..2.722 Mbp (396 bp) score=20
RR11_1289 putative anti-sigma regulatory factor, serine/threonine protein kinase [T] COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RR11:2.748..2.749 Mbp (447 bp) score=20
RR11_1100 NusA antitermination factor [K] COG0195 Transcription elongation factor RR11:3.002..3.004 Mbp (1.626 kbp) score=20
RR11_2994 [J] COG0251 Putative translation initiation inhibitor, yjgF family RR11:3.535..3.535 Mbp (459 bp) score=20
RR11_3508 [J] COG0251 Putative translation initiation inhibitor, yjgF family RR11:3.619..3.619 Mbp (348 bp) score=20
RR11_528 anti-ECFsigma factor, ChrR [T] COG3806 Anti-sigma factor RR11:3.741..3.741 Mbp (636 bp) score=20
RR11_160 mRNA 3'-end processing factor RR11:46.41..47.43 kbp (1.02 kbp) score=10
rsbT [T] COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RR11:170.6..171 kbp (408 bp) score=10
RR11_1135 ATP synthase beta subunit/transription termination factor rho RR11:294..295.1 kbp (1.071 kbp) score=10
RR11_2815 chromosome replication initiation inhibitor protein RR11:518.4..519.3 kbp (891 bp) score=10
RR11_2133 [L] COG0593 ATPase involved in DNA replication initiation RR11:548.7..549.6 kbp (816 bp) score=10
RR11_1804 [O] COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RR11:591.3..592.3 kbp (1.005 kbp) score=10
RR11_1162 [K] COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain RR11:639.3..640.3 kbp (981 bp) score=10
hemK protein-(glutamine-N5) methyltransferase, release factor-specific RR11:691.8..692.6 kbp (858 bp) score=10
cycH [O] COG4235 Cytochrome c biogenesis factor RR11:792.8..794 kbp (1.251 kbp) score=10
moaA_1 molybdenum cofactor biosynthesis protein A RR11:1.012..1.013 Mbp (1.173 kbp) score=10
mfd transcription-repair coupling factor RR11:1.231..1.235 Mbp (3.462 kbp) score=10
hfq [R] COG1923 Uncharacterized host factor I protein RR11:1.242..1.242 Mbp (240 bp) score=10
RR11_2060 [O] COG0309 Hydrogenase maturation factor RR11:1.329..1.33 Mbp (1.314 kbp) score=10
ihfA integration host factor, alpha subunit RR11:1.615..1.615 Mbp (303 bp) score=10
RR11_1803 [R] COG3552 Protein containing von Willebrand factor type A (vWA) domain RR11:1.641..1.642 Mbp (1.269 kbp) score=10
prfC peptide chain release factor 3 RR11:1.68..1.682 Mbp (1.68 kbp) score=10
RR11_2406 [K] COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RR11:1.687..1.688 Mbp (783 bp) score=10
moaA_2 molybdenum cofactor biosynthesis protein A RR11:1.724..1.725 Mbp (1.008 kbp) score=10
rpoH alternative sigma factor RpoH RR11:1.85..1.851 Mbp (897 bp) score=10
uvrB [LK] COG1197 Transcription-repair coupling factor (superfamily II helicase) RR11:2.053..2.056 Mbp (2.199 kbp) score=10
ctaG [O] COG3175 Cytochrome oxidase assembly factor RR11:2.235..2.235 Mbp (588 bp) score=10
ihfB integration host factor, beta subunit RR11:2.386..2.387 Mbp (285 bp) score=10
RR11_1786 [O] COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) RR11:2.407..2.408 Mbp (429 bp) score=10
RR11_1487 von Willebrand factor type A domain protein RR11:2.514..2.515 Mbp (699 bp) score=10
RR11_2458 [O] COG0068 Hydrogenase maturation factor RR11:2.569..2.57 Mbp (948 bp) score=10
moaB molybdenum cofactor biosynthesis protein B RR11:2.577..2.578 Mbp (543 bp) score=10
pcaQ pca operon transcription factor PcaQ RR11:2.631..2.632 Mbp (918 bp) score=10
rho transcription termination factor Rho RR11:2.953..2.954 Mbp (1.272 kbp) score=10
gidA [J] COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation RR11:2.955..2.957 Mbp (1.875 kbp) score=10
dnaA [L] COG0593 ATPase involved in DNA replication initiation RR11:3.081..3.082 Mbp (1.38 kbp) score=10
RR11_2767 [J] COG1186 Protein chain release factor B RR11:3.126..3.127 Mbp (420 bp) score=10
RR11_482 [R] COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) RR11:3.15..3.151 Mbp (924 bp) score=10
nusG transcription termination/antitermination factor NusG RR11:3.338..3.339 Mbp (534 bp) score=10
rpoE RNA polymerase sigma factor protein (sigma-24) RR11:3.417..3.418 Mbp (537 bp) score=10
RR11_720 [K] COG5662 Predicted transmembrane transcriptional regulator (anti-sigma factor) RR11:3.418..3.419 Mbp (789 bp) score=10
RR11_366 molybdenum cofactor biosynthesis domain protein RR11:3.544..3.545 Mbp (723 bp) score=10
xdhC [O] COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family RR11:3.668..3.669 Mbp (954 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70