Roseobase: Roseovarius sp. 217

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: ROS217:300000..400000, ROS217_09190, dnaA, ZP_01034502, ROS217_t23670, ROS217_r07749, translation elongation factor, GELRKAGLNIMMSMKEAGKPVSFVEDCAVPLEHLADYTDRLTEVFHSH GTTGTW.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 96 regions match your request.
Matches on ROS217
overview_ROS217
ROS217_21692 translation elongation factor P COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) ROS217:4.319..4.32 Mbp (564 bp) score=80
ROS217_13331 translation elongation factor G COG0480 Translation elongation factors (GTPases) ROS217:2.639..2.641 Mbp (2.124 kbp) score=60
ROS217_13341 translation elongation factor Tu COG0050 GTPases - translation elongation factors ROS217:2.641..2.642 Mbp (1.176 kbp) score=60
ROS217_16615 translation elongation factor Tu COG0050 GTPases - translation elongation factors ROS217:3.302..3.303 Mbp (1.176 kbp) score=60
tsf elongation factor Ts COG0264 Translation elongation factor Ts ROS217:4.051..4.052 Mbp (873 bp) score=50
ROS217_06334 translation initiation factor COG0361 Translation initiation factor 1 (IF-1) ROS217:1.233..1.234 Mbp (219 bp) score=40
ROS217_10372 transcription elongation factor NusA COG0195 Transcription elongation factor ROS217:2.041..2.043 Mbp (1.62 kbp) score=40
infB translation initiation factor IF-2 COG0532 Translation initiation factor 2 (IF-2; GTPase) ROS217:2.044..2.046 Mbp (2.505 kbp) score=40
ROS217_10472 transcription elongation factor GreA COG0782 Transcription elongation factor ROS217:2.066..2.067 Mbp (471 bp) score=40
ROS217_19162 translation initiation factor COG0290 Translation initiation factor 3 (IF-3) ROS217:3.811..3.812 Mbp (660 bp) score=40
ROS217_01925 COG0050 GTPases - translation elongation factors ROS217:370.4..370.6 kbp (267 bp) score=30
ROS217_02465 COG0480 Translation elongation factors (GTPases) ROS217:457.2..458 kbp (777 bp) score=30
ROS217_13796 anti-anti-sigma factor COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) ROS217:2.72..2.72 Mbp (339 bp) score=30
ROS217_01110 COG0195 Transcription elongation factor ROS217:216.5..216.9 kbp (459 bp) score=20
ROS217_03675 transcription antitermination factor NusB COG0781 Transcription termination factor ROS217:672.5..673 kbp (483 bp) score=20
ROS217_06329 translation initiation factor IF-1 ROS217:1.233..1.233 Mbp (192 bp) score=20
ROS217_08860 molybdopterin converting factor, subunit 2 COG0314 Molybdopterin converting factor, large subunit ROS217:1.737..1.738 Mbp (444 bp) score=20
ROS217_08865 putative molybdopterin MPT converting factor, subunit 1 protein COG1977 Molybdopterin converting factor, small subunit ROS217:1.738..1.738 Mbp (246 bp) score=20
rho transcription termination factor Rho COG1158 Transcription termination factor ROS217:1.902..1.903 Mbp (1.114 kbp) score=20
ROS217_10617 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) ROS217:2.096..2.097 Mbp (684 bp) score=20
ROS217_13256 ribosome-binding factor A COG0858 Ribosome-binding factor A ROS217:2.626..2.627 Mbp (396 bp) score=20
ROS217_13791 anti-sigma B factor, putative COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) ROS217:2.719..2.72 Mbp (387 bp) score=20
ROS217_16110 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB ROS217:3.205..3.205 Mbp (324 bp) score=20
ROS217_17582 Anti-sigma factor ChrR COG3806 Anti-sigma factor ROS217:3.508..3.508 Mbp (657 bp) score=20
ROS217_17677 peptide chain release factor 1 COG0216 Protein chain release factor A ROS217:3.522..3.523 Mbp (1.281 kbp) score=20
ROS217_17767 transcription-repair coupling factor COG1197 Transcription-repair coupling factor (superfamily II helicase) ROS217:3.542..3.546 Mbp (3.453 kbp) score=20
tig trigger factor COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) ROS217:3.629..3.63 Mbp (1.332 kbp) score=20
ROS217_18517 COG0012 Predicted GTPase, probable translation factor ROS217:3.675..3.676 Mbp (462 bp) score=20
ROS217_18527 COG0012 Predicted GTPase, probable translation factor ROS217:3.677..3.678 Mbp (1.098 kbp) score=20
ROS217_19092 peptide chain release factor 2 COG1186 Protein chain release factor B ROS217:3.801..3.802 Mbp (1.128 kbp) score=20
ROS217_21672 peptide chain release factor 3 COG4108 Peptide chain release factor RF-3 ROS217:4.316..4.318 Mbp (1.608 kbp) score=20
ROS217_21687 elongation factor P ROS217:4.319..4.319 Mbp (120 bp) score=20
ROS217_21762 molybdenum cofactor biosynthesis protein A COG2896 Molybdenum cofactor biosynthesis enzyme ROS217:4.335..4.336 Mbp (1.008 kbp) score=20
ROS217_22017 COG0009 Putative translation factor (SUA5) ROS217:4.39..4.391 Mbp (942 bp) score=20
ROS217_22667 molybdenum cofactor biosynthesis protein C COG0315 Molybdenum cofactor biosynthesis enzyme ROS217:4.519..4.519 Mbp (477 bp) score=20
ROS217_22697 ribosome recycling factor COG0233 Ribosome recycling factor ROS217:4.525..4.525 Mbp (564 bp) score=20
ROS217_22847 COG0532 Translation initiation factor 2 (IF-2; GTPase) ROS217:4.558..4.559 Mbp (942 bp) score=20
ROS217_00080 COG0251 Putative translation initiation inhibitor, yjgF family ROS217:17.12..17.51 kbp (393 bp) score=10
ROS217_00895 COG3806 Anti-sigma factor ROS217:177.7..178.4 kbp (669 bp) score=10
ROS217_00985 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase ROS217:193.3..193.5 kbp (186 bp) score=10
ROS217_01300 similar to transforming growth factor-induced protein; COG2335 Secreted and surface protein containing fasciclin-like repeats ROS217:252.5..252.8 kbp (339 bp) score=10
ROS217_02015 similar to transforming growth factor-induced protein; COG2335 Secreted and surface protein containing fasciclin-like repeats ROS217:383.3..383.9 kbp (552 bp) score=10
ROS217_02110 COG0851 Septum formation topological specificity factor ROS217:399.5..399.8 kbp (270 bp) score=10
ROS217_02960 COG4235 Cytochrome c biogenesis factor ROS217:547.8..549 kbp (1.152 kbp) score=10
ROS217_02975 COG1138 Cytochrome c biogenesis factor ROS217:550..552 kbp (1.992 kbp) score=10
ROS217_03275 RNA polymerase sigma-70 factor ROS217:606.6..607.3 kbp (669 bp) score=10
ROS217_03625 RNA polymerase sigma factor ROS217:665.5..666.4 kbp (840 bp) score=10
ROS217_03905 molybdenum cofactor biosynthesis domain protein ROS217:721.8..722.5 kbp (723 bp) score=10
ROS217_04150 COG0251 Putative translation initiation inhibitor, yjgF family ROS217:770.5..771 kbp (462 bp) score=10
ROS217_04175 COG2747 Negative regulator of flagellin synthesis (anti-sigma28 factor) ROS217:773.7..774 kbp (303 bp) score=10
ROS217_04430 COG3175 Cytochrome oxidase assembly factor ROS217:816.3..816.9 kbp (582 bp) score=10
ROS217_04440 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) ROS217:817..818 kbp (957 bp) score=10
ROS217_05009 molybdenum cofactor biosynthesis protein B ROS217:926.6..927.2 kbp (543 bp) score=10
ROS217_05639 sigma factor sigB regulation protein ROS217:1.086..1.087 Mbp (987 bp) score=10
ROS217_05814 COG0728 Uncharacterized membrane protein, putative virulence factor ROS217:1.125..1.126 Mbp (1.539 kbp) score=10
ROS217_07690 COG0251 Putative translation initiation inhibitor, yjgF family ROS217:1.272..1.273 Mbp (465 bp) score=10
ROS217_07405 RNA polymerase sigma-70 factor ROS217:1.334..1.335 Mbp (738 bp) score=10
ROS217_08124 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain ROS217:1.599..1.599 Mbp (723 bp) score=10
ROS217_08379 COG4447 Uncharacterized protein related to plant photosystem II stability/assembly factor ROS217:1.65..1.651 Mbp (1.146 kbp) score=10
ROS217_09030 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) ROS217:1.772..1.772 Mbp (885 bp) score=10
ROS217_09907 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family ROS217:1.94..1.941 Mbp (882 bp) score=10
ROS217_10132 COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) ROS217:1.987..1.988 Mbp (465 bp) score=10
ROS217_11311 COG1186 Protein chain release factor B ROS217:2.236..2.237 Mbp (459 bp) score=10
ROS217_11971 COG0251 Putative translation initiation inhibitor, yjgF family ROS217:2.358..2.358 Mbp (315 bp) score=10
ROS217_13106 probable aggregation factor core protein MAFp3, isoform C ROS217:2.594..2.597 Mbp (3.24 kbp) score=10
ROS217_13146 COG3806 Anti-sigma factor ROS217:2.604..2.605 Mbp (669 bp) score=10
ROS217_13671 RNA polymerase sigma-70 factor ROS217:2.693..2.693 Mbp (171 bp) score=10
ROS217_13861 RNA polymerase sigma-70 factor, ECF family protein ROS217:2.732..2.733 Mbp (594 bp) score=10
ROS217_14226 RNA polymerase sigma factor ROS217:2.811..2.811 Mbp (84 bp) score=10
ROS217_14231 RNA polymerase sigma-32 factor ROS217:2.811..2.811 Mbp (834 bp) score=10
ROS217_14506 putative RpoE6 RNA polymerase sigma factor ROS217:2.862..2.863 Mbp (546 bp) score=10
ROS217_14721 COG0251 Putative translation initiation inhibitor, yjgF family ROS217:2.918..2.919 Mbp (402 bp) score=10
ROS217_15166 maturation factor of nitrous oxide reductase ROS217:3.005..3.006 Mbp (915 bp) score=10
ROS217_16640 transcription termination/antitermination factor NusG ROS217:3.308..3.308 Mbp (534 bp) score=10
ROS217_17122 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain ROS217:3.402..3.404 Mbp (1.743 kbp) score=10
ROS217_17162 RNA polymerase sigma factor ROS217:3.413..3.415 Mbp (1.986 kbp) score=10
ROS217_17487 antisigma-factor antagonist, STAS ROS217:3.488..3.49 Mbp (1.491 kbp) score=10
ROS217_17587 RNA polymerase sigma-70 factor ROS217:3.508..3.509 Mbp (576 bp) score=10
ROS217_17682 COG2890 Methylase of polypeptide chain release factors ROS217:3.523..3.524 Mbp (858 bp) score=10
ROS217_17822 integration host factor beta subunit ROS217:3.555..3.556 Mbp (114 bp) score=10
ROS217_17827 integration host factor, beta subunit ROS217:3.556..3.556 Mbp (282 bp) score=10
ROS217_18582 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation ROS217:3.688..3.69 Mbp (1.359 kbp) score=10
ROS217_20542 iron-sulfur cluster assembly transcription factor IscR, putative ROS217:4.091..4.091 Mbp (462 bp) score=10
ROS217_21012 integration host factor, alpha subunit ROS217:4.182..4.182 Mbp (366 bp) score=10
ROS217_21237 RNA polymerase sigma-70 factor ROS217:4.227..4.227 Mbp (531 bp) score=10
ROS217_21257 COG1923 Uncharacterized host factor I protein ROS217:4.231..4.231 Mbp (240 bp) score=10
ROS217_21282 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor ROS217:4.237..4.237 Mbp (771 bp) score=10
ROS217_21437 COG1138 Cytochrome c biogenesis factor ROS217:4.268..4.27 Mbp (1.965 kbp) score=10
ROS217_21517 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family ROS217:4.287..4.288 Mbp (972 bp) score=10
ROS217_21522 COG3552 Protein containing von Willebrand factor type A (vWA) domain ROS217:4.288..4.289 Mbp (1.269 kbp) score=10
ROS217_22532 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase ROS217:4.489..4.491 Mbp (2.202 kbp) score=10
ROS217_22672 molybdenum cofactor biosynthesis protein A ROS217:4.519..4.52 Mbp (1.173 kbp) score=10
ROS217_22732 COG3552 Protein containing von Willebrand factor type A (vWA) domain ROS217:4.532..4.533 Mbp (1.182 kbp) score=10
ROS217_22737 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family ROS217:4.533..4.534 Mbp (756 bp) score=10
ROS217_23172 similar to transforming growth factor-induced protein; COG2335 Secreted and surface protein containing fasciclin-like repeats ROS217:4.631..4.631 Mbp (564 bp) score=10
ROS217_23795 COG4235 Cytochrome c biogenesis factor ROS217:4.743..4.745 Mbp (1.233 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70