Roseobase: Roseobacter litoralis Och 149

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RLO149:500000..600000, RLO149_c000010, RLO149_p630010, addB, YP_004688858, transcriptional regulator, WGQLRQRLLKTVGQNNYKNWIEPIEFGNTQDGVATF.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 222 regions match your request.
Matches on RLO149
overview_RLO149
hmrR HTH-type transcriptional regulator copper efflux regulator RLO149:2.237..2.238 Mbp (402 bp) score=30
hmrR HTH-type transcriptional regulator copper efflux regulator RLO149:2.237..2.238 Mbp (402 bp) score=30
RLO149_c021930 HTH-type transcriptional regulator gbpR galactose-binding protein regulator RLO149:2.242..2.243 Mbp (933 bp) score=30
RLO149_c000270 HTH-type LacI family transcriptional regulator RLO149:29.52..30.56 kbp (1.044 kbp) score=20
RLO149_c000390 LysR family transcriptional regulator RLO149:40.77..41.66 kbp (894 bp) score=20
RLO149_c000640 AraC family transcriptional regulator RLO149:68.31..69.3 kbp (984 bp) score=20
RLO149_c000710 LysR family transcriptional regulator RLO149:75.28..76.19 kbp (909 bp) score=20
RLO149_c000920 TetR family transcriptional regulator RLO149:96.66..97.28 kbp (615 bp) score=20
RLO149_c001680 LysR family transcriptional regulator RLO149:160.3..161.2 kbp (906 bp) score=20
RLO149_c001750 AraC family transcriptional regulator RLO149:167.3..168.1 kbp (867 bp) score=20
RLO149_c001870 GntR family transcriptional regulator RLO149:182..183.5 kbp (1.482 kbp) score=20
RLO149_c001980 HTH-type ArsR family transcriptional regulator RLO149:196.3..196.6 kbp (315 bp) score=20
RLO149_c002030 GntR family transcriptional regulator RLO149:199.4..200 kbp (651 bp) score=20
RLO149_c002390 HTH-type transcriptional regulator RLO149:239.9..240.3 kbp (477 bp) score=20
RLO149_c002550 GntR family transcriptional regulator RLO149:253.3..254 kbp (726 bp) score=20
RLO149_c002600 HTH-type DeoR family transcriptional regulator RLO149:257.7..258.5 kbp (828 bp) score=20
RLO149_c002930 AraC family transcriptional regulator RLO149:289.5..290.3 kbp (741 bp) score=20
RLO149_c003270 LysR family transcriptional regulator RLO149:338.3..339.3 kbp (930 bp) score=20
RLO149_c003300 LysR family transcriptional regulator RLO149:341.9..342.7 kbp (885 bp) score=20
RLO149_c003350 LysR family transcriptional regulator RLO149:350.2..351.2 kbp (936 bp) score=20
RLO149_c003690 HTH-type IclR family transcriptional regulator RLO149:389..389.8 kbp (780 bp) score=20
RLO149_c004410 GntR family transcriptional regulator RLO149:469.3..470 kbp (687 bp) score=20
RLO149_c004700 HTH-type MerR family transcriptional regulator RLO149:500.2..500.6 kbp (414 bp) score=20
RLO149_c004710 HTH-type LuxR family transcriptional regulator RLO149:500.8..501.6 kbp (747 bp) score=20
RLO149_c004730 HTH-type MerR family transcriptional regulator RLO149:501.9..502.3 kbp (372 bp) score=20
RLO149_c004810 LysR family transcriptional regulator RLO149:508.8..509.7 kbp (903 bp) score=20
RLO149_c004910 HTH-type transcriptional regulator LacI family RLO149:519.9..520.9 kbp (1.017 kbp) score=20
RLO149_c005660 AraC family transcriptional regulator RLO149:591.5..592.6 kbp (1.038 kbp) score=20
RLO149_c005680 LysR family transcriptional regulator RLO149:593.2..594.1 kbp (897 bp) score=20
RLO149_c006380 HTH-type LacI family transcriptional regulator RLO149:666.1..667.1 kbp (1.023 kbp) score=20
RLO149_c006540 GntR family transcriptional regulator RLO149:679..679.6 kbp (672 bp) score=20
RLO149_c006590 AraC family transcriptional regulator RLO149:683.5..684.5 kbp (1.014 kbp) score=20
RLO149_c007080 GntR family transcriptional regulator RLO149:752.2..753.3 kbp (1.005 kbp) score=20
RLO149_c007220 HTH-type transcriptional regulator, sigma-54 dependent RLO149:767.6..769.4 kbp (1.764 kbp) score=20
RLO149_c007240 GntR family transcriptional regulator RLO149:771.4..772 kbp (648 bp) score=20
cuyR LysR family transcriptional regulator RLO149:796.5..797.5 kbp (945 bp) score=20
RLO149_c007600 LysR family transcriptional regulator RLO149:816.6..817.5 kbp (903 bp) score=20
RLO149_c007780 HTH-type transcriptional regulator of taurine degradation operon RLO149:839.5..840.9 kbp (1.488 kbp) score=20
RLO149_c007890 TetR family transcriptional regulator RLO149:850.8..851.5 kbp (669 bp) score=20
dorR DMSOR/TMAOR two component transcriptional regulator DorR RLO149:858.7..859.4 kbp (705 bp) score=20
RLO149_c008080 transcriptional regulator RLO149:871.6..872.1 kbp (471 bp) score=20
RLO149_c008130 transcriptional regulator RLO149:876.2..876.7 kbp (510 bp) score=20
RLO149_c008150 IclR family transcriptional regulator RLO149:879..879.8 kbp (807 bp) score=20
RLO149_c008260 sugar-binding transcriptional regulator RLO149:888.9..889.8 kbp (957 bp) score=20
RLO149_c008510 transcriptional regulator RLO149:916.4..917.4 kbp (975 bp) score=20
RLO149_c008520 transcriptional regulator of thi operon RLO149:917.7..917.7 kbp (75 bp) score=20
RLO149_c008640 transcriptional regulator-like protein RLO149:926.4..926.9 kbp (480 bp) score=20
RLO149_c008750 MarR family transcriptional regulator RLO149:934.7..935.2 kbp (522 bp) score=20
RLO149_c008800 MarR family transcriptional regulator RLO149:938.3..938.7 kbp (441 bp) score=20
RLO149_c008810 AraC family transcriptional regulator RLO149:939.1..939.9 kbp (855 bp) score=20
RLO149_c008870 transcriptional regulator RLO149:945.9..946.9 kbp (1.029 kbp) score=20
RLO149_c009040 LysR family transcriptional regulator RLO149:957.9..958.8 kbp (879 bp) score=20
RLO149_c009110 transcriptional regulator RLO149:964.4..965.3 kbp (909 bp) score=20
RLO149_c009200 LysR family transcriptional regulator RLO149:972.9..973.9 kbp (939 bp) score=20
RLO149_c009270 transcriptional regulator RLO149:980.6..981.1 kbp (423 bp) score=20
RLO149_c009590 LysR family transcriptional regulator RLO149:1.01..1.011 Mbp (930 bp) score=20
RLO149_c009650 transcriptional regulatorm marR family RLO149:1.015..1.016 Mbp (513 bp) score=20
RLO149_c010500 AsnC family transcriptional regulator RLO149:1.096..1.097 Mbp (456 bp) score=20
RLO149_c010510 AsnC family transcriptional regulator RLO149:1.097..1.097 Mbp (456 bp) score=20
RLO149_c010560 GntR family transcriptional regulator RLO149:1.101..1.102 Mbp (648 bp) score=20
RLO149_c011490 LysR family transcriptional regulator RLO149:1.184..1.185 Mbp (876 bp) score=20
betI HTH-type transcriptional regulator BetI RLO149:1.2..1.201 Mbp (576 bp) score=20
RLO149_c013120 HTH-type transcriptional regulator RLO149:1.351..1.352 Mbp (873 bp) score=20
RLO149_c013400 TetR family transcriptional regulator RLO149:1.386..1.386 Mbp (621 bp) score=20
RLO149_c014410 LysR family transcriptional regulator RLO149:1.482..1.483 Mbp (897 bp) score=20
RLO149_c014650 HTH-type AsnC family transcriptional regulator RLO149:1.504..1.505 Mbp (462 bp) score=20
RLO149_c014960 transcriptional regulatory protein RLO149:1.532..1.533 Mbp (705 bp) score=20
RLO149_c015150 HTH-type LacI family transcriptional regulator RLO149:1.557..1.557 Mbp (954 bp) score=20
RLO149_c015420 GntR family transcriptional regulator RLO149:1.583..1.584 Mbp (672 bp) score=20
RLO149_c015430 HTH-type IclR family transcriptional regulator RLO149:1.584..1.585 Mbp (867 bp) score=20
RLO149_c015800 HTH-type IclR family transcriptional regulator RLO149:1.632..1.633 Mbp (792 bp) score=20
RLO149_c016300 transcriptional regulatory protein RLO149:1.683..1.683 Mbp (657 bp) score=20
RLO149_c016530 TetR family transcriptional regulator RLO149:1.705..1.705 Mbp (624 bp) score=20
RLO149_c016620 TetR family transcriptional regulator RLO149:1.713..1.714 Mbp (591 bp) score=20
RLO149_c016850 HTH-type transcriptional regulator RLO149:1.73..1.731 Mbp (720 bp) score=20
RLO149_c017050 GntR family transcriptional regulator RLO149:1.75..1.751 Mbp (681 bp) score=20
RLO149_c017100 HTH-type DeoR family transcriptional regulator RLO149:1.755..1.756 Mbp (798 bp) score=20
RLO149_c017250 LysR family transcriptional regulator RLO149:1.77..1.771 Mbp (903 bp) score=20
RLO149_c017410 HTH-type transcriptional regulator RLO149:1.787..1.788 Mbp (903 bp) score=20
RLO149_c018120 HTH-type transcriptional regulator RLO149:1.863..1.864 Mbp (660 bp) score=20
RLO149_c018450 HTH-type AsnC family transcriptional regulator RLO149:1.901..1.902 Mbp (456 bp) score=20
RLO149_c018510 HTH-type transcriptional regulator Rrf2 RLO149:1.905..1.906 Mbp (474 bp) score=20
RLO149_c019270 AraC family transcriptional regulator RLO149:1.977..1.978 Mbp (1.005 kbp) score=20
ctrA cell cycle transcriptional regulator RLO149:2.008..2.009 Mbp (720 bp) score=20
RLO149_c019730 transcriptional regulator-like protein RLO149:2.024..2.025 Mbp (804 bp) score=20
RLO149_c020630 LysR family transcriptional regulator RLO149:2.109..2.11 Mbp (720 bp) score=20
RLO149_c020770 HTH-type transcriptional regulator-like protein RLO149:2.125..2.125 Mbp (897 bp) score=20
RLO149_c020830 HTH-type sugar binding transcriptional regulator RLO149:2.131..2.132 Mbp (1.014 kbp) score=20
RLO149_c020890 HTH-type IclR family transcriptional regulator RLO149:2.139..2.139 Mbp (783 bp) score=20
RLO149_c020950 LysR family transcriptional regulator RLO149:2.144..2.145 Mbp (885 bp) score=20
RLO149_c021090 HTH-type transcriptional regulator-like protein RLO149:2.157..2.158 Mbp (624 bp) score=20
RLO149_c021260 HTH-type transcriptional regulator-like protein RLO149:2.17..2.17 Mbp (291 bp) score=20
RLO149_c021300 HTH-type transcriptional regulator RLO149:2.172..2.173 Mbp (408 bp) score=20
RLO149_c021310 AraC family transcriptional regulator RLO149:2.173..2.174 Mbp (903 bp) score=20
RLO149_c021320 TetR family transcriptional regulator RLO149:2.174..2.175 Mbp (615 bp) score=20
aglR HTH-type transcriptional regulator RLO149:2.223..2.224 Mbp (1.083 kbp) score=20
ompR putative transcriptional regulatory protein OmpR RLO149:2.25..2.251 Mbp (726 bp) score=20
ompR transcriptional regulator OmpR RLO149:2.25..2.251 Mbp (726 bp) score=20
RLO149_c022390 GntR family transcriptional regulator RLO149:2.294..2.295 Mbp (732 bp) score=20
dctD C4-dicarboxylate transport transcriptional regulatory protein DctD RLO149:2.307..2.308 Mbp (1.335 kbp) score=20
RLO149_c022830 HTH-type transcriptional regulator-like protein RLO149:2.332..2.332 Mbp (336 bp) score=20
RLO149_c022940 LytTr transcriptional regulator-like protein RLO149:2.351..2.352 Mbp (780 bp) score=20
RLO149_c023010 GntR family transcriptional regulator RLO149:2.357..2.357 Mbp (699 bp) score=20
rhaR HTH-type transcriptional regulator, DeoR-like protein RLO149:2.366..2.367 Mbp (813 bp) score=20
fixJ transcriptional regulator FixJ RLO149:2.373..2.374 Mbp (642 bp) score=20
RLO149_c023330 HTH-type transcriptional regulator RLO149:2.392..2.393 Mbp (609 bp) score=20
RLO149_c023860 MerR family transcriptional regulator RLO149:2.444..2.445 Mbp (1.236 kbp) score=20
RLO149_c024510 LysR family transcriptional regulator RLO149:2.513..2.514 Mbp (906 bp) score=20
RLO149_c026160 HTH-type AsnC family transcriptional regulator RLO149:2.685..2.686 Mbp (240 bp) score=20
RLO149_c026330 HTH-type DeoR family transcriptional regulator RLO149:2.699..2.7 Mbp (780 bp) score=20
RLO149_c026400 HTH-type DeoR family transcriptional regulator RLO149:2.706..2.706 Mbp (780 bp) score=20
RLO149_c026430 HTH-type LuxR family transcriptional regulator RLO149:2.71..2.711 Mbp (615 bp) score=20
RLO149_c026490 GntR family transcriptional regulator RLO149:2.714..2.714 Mbp (741 bp) score=20
RLO149_c026790 HTH-type LacI family transcriptional regulator RLO149:2.743..2.744 Mbp (1.032 kbp) score=20
RLO149_c026890 HTH-type ArsR family transcriptional regulator RLO149:2.752..2.752 Mbp (315 bp) score=20
RLO149_c027540 LysR family transcriptional regulator RLO149:2.813..2.814 Mbp (933 bp) score=20
RLO149_c028130 transcriptional regulator RLO149:2.873..2.873 Mbp (807 bp) score=20
RLO149_c028140 HTH-type transcriptional regulator-like protein RLO149:2.873..2.875 Mbp (1.437 kbp) score=20
RLO149_c028740 LysR family transcriptional regulator RLO149:2.935..2.936 Mbp (900 bp) score=20
hpdR HTH-type transcriptional regulator for hpd expression RLO149:2.95..2.951 Mbp (456 bp) score=20
RLO149_c028950 CarD family transcriptional regulator RLO149:2.954..2.955 Mbp (513 bp) score=20
RLO149_c029090 AraC family transcriptional regulator RLO149:2.969..2.97 Mbp (1.014 kbp) score=20
metR HTH-type transcriptional regulator MetR RLO149:3.013..3.014 Mbp (906 bp) score=20
RLO149_c029910 GntR family transcriptional regulator RLO149:3.047..3.048 Mbp (759 bp) score=20
RLO149_c029990 GntR family transcriptional regulator RLO149:3.055..3.056 Mbp (702 bp) score=20
RLO149_c030140 AraC family transcriptional regulator RLO149:3.072..3.073 Mbp (1.005 kbp) score=20
RLO149_c030690 HTH-type LuxR family transcriptional regulator RLO149:3.128..3.129 Mbp (495 bp) score=20
RLO149_c031480 cyclic nucleotide binding transcriptional regulator RLO149:3.229..3.23 Mbp (822 bp) score=20
RLO149_c031490 cyclic nucleotide binding transcriptional regulator RLO149:3.23..3.231 Mbp (693 bp) score=20
RLO149_c031680 HTH-type MarR family transcriptional regulator RLO149:3.254..3.255 Mbp (459 bp) score=20
soxR1 HTH-type ArsR family transcriptional regulator RLO149:3.279..3.279 Mbp (393 bp) score=20
RLO149_c032040 HTH-type RpiR family transcriptional regulator RLO149:3.289..3.29 Mbp (858 bp) score=20
RLO149_c032210 TetR family transcriptional regulator RLO149:3.314..3.315 Mbp (726 bp) score=20
RLO149_c032330 GntR family transcriptional regulator RLO149:3.326..3.327 Mbp (1.464 kbp) score=20
RLO149_c032430 HTH-type AsnC family transcriptional regulator RLO149:3.336..3.337 Mbp (498 bp) score=20
RLO149_c032480 AraC family transcriptional regulator RLO149:3.339..3.34 Mbp (1.035 kbp) score=20
RLO149_c032550 transcriptional regulator-like protein RLO149:3.348..3.349 Mbp (891 bp) score=20
RLO149_c032890 TetR family transcriptional regulator RLO149:3.381..3.382 Mbp (645 bp) score=20
RLO149_c032930 LysR family transcriptional regulator RLO149:3.384..3.385 Mbp (969 bp) score=20
RLO149_c034110 transcriptional regulator-like protein RLO149:3.476..3.477 Mbp (900 bp) score=20
RLO149_c034420 TetR family transcriptional regulator RLO149:3.502..3.502 Mbp (696 bp) score=20
RLO149_c034580 GntR family transcriptional regulator RLO149:3.52..3.521 Mbp (786 bp) score=20
RLO149_c034660 LysR family transcriptional regulator RLO149:3.525..3.526 Mbp (882 bp) score=20
RLO149_c036110 LysR family transcriptional regulator RLO149:3.667..3.667 Mbp (840 bp) score=20
RLO149_c036840 HTH-type LuxR family transcriptional regulator RLO149:3.727..3.727 Mbp (666 bp) score=20
RLO149_c037020 AraC family transcriptional regulator RLO149:3.741..3.742 Mbp (1.035 kbp) score=20
RLO149_c037810 HTH-type LuxR family transcriptional regulator RLO149:3.826..3.827 Mbp (720 bp) score=20
RLO149_c038080 HTH-type transcriptional regulator-like protein RLO149:3.857..3.857 Mbp (222 bp) score=20
RLO149_c038130 HTH-type ArsR family transcriptional regulator RLO149:3.861..3.861 Mbp (684 bp) score=20
RLO149_c038600 GntR family transcriptional regulator RLO149:3.91..3.911 Mbp (678 bp) score=20
RLO149_c039130 HTH-type transcriptional regulator RLO149:3.967..3.967 Mbp (573 bp) score=20
RLO149_c039720 LysR family transcriptional regulator RLO149:4.024..4.025 Mbp (879 bp) score=20
RLO149_c039790 XRE family transcriptional regulator RLO149:4.03..4.03 Mbp (774 bp) score=20
RLO149_c039960 LysR family transcriptional regulator RLO149:4.049..4.049 Mbp (912 bp) score=20
RLO149_c040120 LysR family transcriptional regulator RLO149:4.061..4.062 Mbp (903 bp) score=20
petP HTH-type transcriptional regulator PetP RLO149:4.099..4.1 Mbp (513 bp) score=20
RLO149_c040910 TetR family transcriptional regulator RLO149:4.135..4.135 Mbp (639 bp) score=20
RLO149_c041160 HTH-type LacI family transcriptional regulator RLO149:4.159..4.16 Mbp (999 bp) score=20
RLO149_c042040 HTH-type MarR family transcriptional regulator RLO149:4.251..4.251 Mbp (444 bp) score=20
RLO149_c042680 TetR family transcriptional regulator RLO149:4.326..4.327 Mbp (618 bp) score=20
RLO149_c043110 LysR family transcriptional regulator RLO149:4.367..4.368 Mbp (852 bp) score=20
RLO149_c043300 HTH-type LacI family transcriptional regulator RLO149:4.388..4.389 Mbp (993 bp) score=20
RLO149_c043310 AraC family transcriptional regulator RLO149:4.389..4.39 Mbp (891 bp) score=20
RLO149_c043340 AraC family transcriptional regulator RLO149:4.391..4.392 Mbp (1.029 kbp) score=20
RLO149_c043770 GntR family transcriptional regulator RLO149:4.422..4.423 Mbp (660 bp) score=20
RLO149_c044000 TetR family transcriptional regulator RLO149:4.446..4.447 Mbp (639 bp) score=20
RLO149_c044520 HTH-type transcriptional regulator RLO149:4.498..4.498 Mbp (564 bp) score=20
RLO149_p830060 putative HTH-type transcriptional regulator, LysR family RLO149:4.575..4.576 Mbp (879 bp) score=20
RLO149_p830100 putative HTH-type transcriptional regulator RLO149:4.578..4.578 Mbp (417 bp) score=20
RLO149_p830260 putative HTH-type transcriptional regulator RLO149:4.587..4.588 Mbp (429 bp) score=20
RLO149_p940530 HTH-type transcriptional regulator, LysR family RLO149:4.707..4.708 Mbp (981 bp) score=20
ppsR transcriptional regulator PpsR RLO149:4.725..4.727 Mbp (1.428 kbp) score=20
RLO149_p940690 putative transcriptional regulator PpaA RLO149:4.727..4.728 Mbp (783 bp) score=20
phyR phyllosphere induced regulator RLO149:110.4..111.3 kbp (813 bp) score=10
RLO149_c001160 HTH-type transcripitional regulator, crp family, with a cNMP-binding site RLO149:117..117.8 kbp (729 bp) score=10
glnB1 nitrogen regulatory protein P-II RLO149:144.8..145.1 kbp (339 bp) score=10
lrp1 leucine-responsive regulatory protein Lrp RLO149:201.7..202.2 kbp (453 bp) score=10
RLO149_c005100 ferric uptake regulator family protein RLO149:537.9..538.3 kbp (420 bp) score=10
RLO149_c005500 HTH-type regulatory protein-like protein RLO149:575.2..576.2 kbp (1.023 kbp) score=10
RLO149_c009480 response regulator receiver protein RLO149:998.2..999.1 kbp (912 bp) score=10
RLO149_c013460 transcriptional repressor RLO149:1.391..1.392 Mbp (1.209 kbp) score=10
RLO149_c013750 response regulator receiver protein, CheY like protein RLO149:1.416..1.417 Mbp (366 bp) score=10
RLO149_c015990 response regulator receiver protein, CheY like protein RLO149:1.651..1.651 Mbp (384 bp) score=10
RLO149_c017580 response regulator RLO149:1.803..1.803 Mbp (396 bp) score=10
RLO149_c017600 response regulator RLO149:1.805..1.805 Mbp (435 bp) score=10
RLO149_c017620 response regulator RLO149:1.806..1.807 Mbp (465 bp) score=10
RLO149_c017710 prophage regulatory protein RLO149:1.821..1.821 Mbp (309 bp) score=10
ntrX nitrogen assimilation regulatory protein NtrX RLO149:1.842..1.843 Mbp (1.413 kbp) score=10
phoU phosphate transport system regulatory protein PhoU RLO149:1.965..1.965 Mbp (720 bp) score=10
glnB2 nitrogen regulatory protein P-II RLO149:2.034..2.034 Mbp (339 bp) score=10
RLO149_c020280 diguanylate cyclase response regulator RLO149:2.076..2.077 Mbp (1.403 kbp) score=10
RLO149_c021850 regulatory DNA binding protein RLO149:2.233..2.234 Mbp (717 bp) score=10
RLO149_c022070 regulatory DNA binding protein RLO149:2.262..2.264 Mbp (1.353 kbp) score=10
RLO149_c022080 regulatory DNA binding protein RLO149:2.264..2.265 Mbp (807 bp) score=10
RLO149_c022140 regulatory DNA binding protein RLO149:2.269..2.27 Mbp (1.755 kbp) score=10
RLO149_c022850 phage regulator-like protein RLO149:2.336..2.337 Mbp (291 bp) score=10
RLO149_c023360 regulatory protein RLO149:2.396..2.399 Mbp (3.255 kbp) score=10
fur ferric uptake regulator protein Fur RLO149:2.429..2.43 Mbp (414 bp) score=10
cheB chemotaxis response regulator protein-glutamate methylesterase CheB RLO149:2.665..2.667 Mbp (1.134 kbp) score=10
lrp2 leucine-responsive regulatory protein Lrp RLO149:2.767..2.768 Mbp (498 bp) score=10
soxR2 redox-sensitive transcriptional activator SoxR RLO149:2.821..2.822 Mbp (447 bp) score=10
amiR aliphatic amidase regulator RLO149:2.889..2.89 Mbp (609 bp) score=10
nrdR transcriptional repressor NrdR RLO149:2.976..2.977 Mbp (468 bp) score=10
RLO149_c029230 transcriptional activator HlyU RLO149:2.978..2.978 Mbp (285 bp) score=10
nsrR HTH-type transcriptional repressor NsrR RLO149:3.083..3.084 Mbp (450 bp) score=10
RLO149_c030370 GcrA cell cycle regulator RLO149:3.097..3.097 Mbp (564 bp) score=10
nocR regulatory protein NocR RLO149:3.439..3.439 Mbp (909 bp) score=10
chvI two component signal transduction response regulator receiver protein ChvI RLO149:3.472..3.473 Mbp (702 bp) score=10
RLO149_c034520 response regulator receiver-like protein RLO149:3.512..3.512 Mbp (387 bp) score=10
RLO149_c034640 HTH-type transcriptional repressor, arsR family RLO149:3.523..3.524 Mbp (339 bp) score=10
fnrL transcriptional activator protein FnrL RLO149:3.566..3.567 Mbp (744 bp) score=10
RLO149_c036000 signal transduction response regulator receiver protein RLO149:3.656..3.656 Mbp (720 bp) score=10
RLO149_c036910 two component signal transduction response regulator receiver protein RLO149:3.732..3.733 Mbp (681 bp) score=10
chrR transcriptional activator ChrR RLO149:3.902..3.903 Mbp (654 bp) score=10
RLO149_c039320 response regulator receiver protein RLO149:3.984..3.985 Mbp (687 bp) score=10
RLO149_c039900 response regulator receiver protein RLO149:4.044..4.045 Mbp (642 bp) score=10
RLO149_c040230 two component signal transduction response regulator receiver protein RLO149:4.073..4.074 Mbp (672 bp) score=10
regA photosynthetic apparatus regulatory protein RegA RLO149:4.187..4.188 Mbp (555 bp) score=10
RLO149_c041870 response regulator receiver protein RLO149:4.234..4.236 Mbp (1.29 kbp) score=10
ptsN nitrogen regulatory protein PtsN RLO149:4.275..4.275 Mbp (465 bp) score=10
RLO149_p830190 regulatory-like protein RLO149:4.583..4.583 Mbp (465 bp) score=10
RLO149_p940370 response regulator receiver protein RLO149:4.69..4.691 Mbp (810 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70