Roseobase: Roseobacter sp. CCS2

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RCCS2:500000..600000, RCCS2_00527, aspS, ZP_01752057, RCCS2_t16274, transcriptional regulator, MAGHSKWANIQHRKGRQDKLRSKLFSKLAKEITVAAKMGDPDPDKNPRLR.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 198 regions match your request.
Matches on RCCS2
overview_RCCS2
RCCS2_00122 transcriptional regulator, GntR family protein COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RCCS2:18.32..19.72 kbp (1.404 kbp) score=40
RCCS2_00147 transcriptional regulator, TetR family, putative COG1309 Transcriptional regulator RCCS2:22.29..22.91 kbp (618 bp) score=40
RCCS2_00252 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RCCS2:44.33..44.78 kbp (453 bp) score=40
RCCS2_00472 putative transcriptional regulator COG1396 Predicted transcriptional regulators RCCS2:91.96..92.39 kbp (432 bp) score=40
RCCS2_00552 transcriptional regulator, BadM/Rrf2 family protein COG1959 Predicted transcriptional regulator RCCS2:107..107.4 kbp (375 bp) score=40
RCCS2_00602 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RCCS2:117.2..118.2 kbp (999 bp) score=40
RCCS2_00734 transcriptional regulator, AraC family protein COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RCCS2:142.6..143.6 kbp (996 bp) score=40
RCCS2_01114 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:220.9..221.8 kbp (939 bp) score=40
RCCS2_01224 transcriptional regulator, BadM/Rrf2 family protein COG1959 Predicted transcriptional regulator RCCS2:240..240.5 kbp (465 bp) score=40
RCCS2_01314 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RCCS2:253.5..254 kbp (543 bp) score=40
RCCS2_01454 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RCCS2:279.2..279.8 kbp (564 bp) score=40
RCCS2_01503 transcriptional regulator NanR COG2186 Transcriptional regulators RCCS2:287.9..288.7 kbp (717 bp) score=40
RCCS2_02213 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RCCS2:418.6..419 kbp (339 bp) score=40
RCCS2_02318 putative transcriptional regulator COG1733 Predicted transcriptional regulators RCCS2:436..436.3 kbp (381 bp) score=40
RCCS2_02970 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RCCS2:559.4..560 kbp (684 bp) score=40
RCCS2_03132 transcriptional regulator, LysR family, putative COG0583 Transcriptional regulator RCCS2:590.7..591.6 kbp (906 bp) score=40
RCCS2_03172 transcriptional regulator SoxR COG0640 Predicted transcriptional regulators RCCS2:597.5..597.8 kbp (348 bp) score=40
RCCS2_03217 transcriptional regulator, putative COG3800 Predicted transcriptional regulator RCCS2:604.6..605.8 kbp (1.155 kbp) score=40
RCCS2_03399 transcriptional regulator, CarD family, putative COG1329 Transcriptional regulators, similar to M. xanthus CarD RCCS2:635.1..635.6 kbp (507 bp) score=40
RCCS2_03639 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RCCS2:679.2..679.8 kbp (597 bp) score=40
RCCS2_03699 transcriptional regulator, putative COG3682 Predicted transcriptional regulator RCCS2:690..690.4 kbp (396 bp) score=40
RCCS2_03769 transcriptional regulator, putative COG0789 Predicted transcriptional regulators RCCS2:702.3..702.7 kbp (369 bp) score=40
RCCS2_03774 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RCCS2:703..703.4 kbp (402 bp) score=40
RCCS2_04304 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:802.4..803.3 kbp (885 bp) score=40
RCCS2_04314 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RCCS2:804.6..805.1 kbp (447 bp) score=40
RCCS2_04499 transcriptional regulatory protein COG0583 Transcriptional regulator RCCS2:847.9..848.8 kbp (903 bp) score=40
RCCS2_04544 HTH-type transcriptional regulator metR COG0583 Transcriptional regulator RCCS2:859.9..860.8 kbp (909 bp) score=40
RCCS2_04719 transcriptional regulator, gntR family, putative COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RCCS2:892.7..894.2 kbp (1.461 kbp) score=40
RCCS2_04774 transcriptional regulator, IclR family protein COG1414 Transcriptional regulator RCCS2:905.4..906.2 kbp (807 bp) score=40
RCCS2_05284 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RCCS2:1.006..1.007 Mbp (1.005 kbp) score=40
RCCS2_05599 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RCCS2:1.07..1.071 Mbp (675 bp) score=40
RCCS2_05904 probable transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RCCS2:1.124..1.124 Mbp (300 bp) score=40
RCCS2_05964 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RCCS2:1.136..1.137 Mbp (1.026 kbp) score=40
RCCS2_06164 putative transcriptional regulator COG1396 Predicted transcriptional regulators RCCS2:1.182..1.182 Mbp (228 bp) score=40
RCCS2_06214 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:1.189..1.19 Mbp (909 bp) score=40
RCCS2_06379 Cu(I)-responsive transcriptional regulator COG0789 Predicted transcriptional regulators RCCS2:1.216..1.217 Mbp (396 bp) score=40
RCCS2_06429 transcriptional regulator, IclR family protein COG1414 Transcriptional regulator RCCS2:1.225..1.226 Mbp (828 bp) score=40
RCCS2_06759 transcriptional regulator, AraC family protein COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RCCS2:1.287..1.288 Mbp (945 bp) score=40
RCCS2_06829 transcriptional regulator, XRE family protein COG3655 Predicted transcriptional regulator RCCS2:1.301..1.302 Mbp (249 bp) score=40
RCCS2_07234 Predicted transcriptional regulator COG1475 Predicted transcriptional regulators RCCS2:1.375..1.376 Mbp (900 bp) score=40
RCCS2_07239 Predicted transcriptional regulator COG1475 Predicted transcriptional regulators RCCS2:1.376..1.377 Mbp (903 bp) score=40
RCCS2_07499 transcriptional regulator, LysR family, putative COG0583 Transcriptional regulator RCCS2:1.421..1.422 Mbp (888 bp) score=40
RCCS2_07574 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:1.433..1.434 Mbp (942 bp) score=40
RCCS2_08569 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RCCS2:1.617..1.618 Mbp (615 bp) score=40
RCCS2_08664 putative transcriptional regulatory protein COG1309 Transcriptional regulator RCCS2:1.634..1.634 Mbp (531 bp) score=40
RCCS2_08669 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RCCS2:1.634..1.636 Mbp (1.089 kbp) score=40
RCCS2_08924 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RCCS2:1.686..1.686 Mbp (657 bp) score=40
RCCS2_08964 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RCCS2:1.695..1.695 Mbp (594 bp) score=40
RCCS2_09059 transcriptional regulator GntR COG1609 Transcriptional regulators RCCS2:1.716..1.717 Mbp (1.011 kbp) score=40
RCCS2_09209 transcriptional regulator COG1846 Transcriptional regulators RCCS2:1.746..1.747 Mbp (462 bp) score=40
RCCS2_09249 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:1.752..1.753 Mbp (915 bp) score=40
RCCS2_09799 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RCCS2:1.863..1.864 Mbp (444 bp) score=40
RCCS2_10140 transcriptional regulator, gntR family, putative COG1802 Transcriptional regulators RCCS2:1.928..1.929 Mbp (669 bp) score=40
RCCS2_10435 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:1.973..1.974 Mbp (981 bp) score=40
RCCS2_10575 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RCCS2:2.008..2.008 Mbp (507 bp) score=40
RCCS2_11187 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:2.132..2.133 Mbp (885 bp) score=40
RCCS2_11202 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:2.136..2.137 Mbp (858 bp) score=40
RCCS2_11729 tetR-family transcriptional regulator, putative COG1309 Transcriptional regulator RCCS2:2.225..2.226 Mbp (618 bp) score=40
RCCS2_11824 probable deoR-family transcriptional regulator COG2378 Predicted transcriptional regulator RCCS2:2.245..2.246 Mbp (729 bp) score=40
RCCS2_11954 transcriptional regulator, AsnC family, putative COG1522 Transcriptional regulators RCCS2:2.282..2.283 Mbp (459 bp) score=40
RCCS2_12144 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RCCS2:2.314..2.315 Mbp (618 bp) score=40
RCCS2_12294 putative transcriptional regulator COG1386 Predicted transcriptional regulator containing the HTH domain RCCS2:2.338..2.339 Mbp (651 bp) score=40
RCCS2_12314 transcriptional regulator, BadM/Rrf2 family protein COG1959 Predicted transcriptional regulator RCCS2:2.34..2.341 Mbp (378 bp) score=40
RCCS2_12589 transcriptional regulator lysR family, putative COG0583 Transcriptional regulator RCCS2:2.395..2.396 Mbp (876 bp) score=40
RCCS2_12639 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RCCS2:2.406..2.407 Mbp (981 bp) score=40
RCCS2_12724 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RCCS2:2.42..2.42 Mbp (495 bp) score=40
RCCS2_13059 transcriptional regulator, LysR family, putative COG0583 Transcriptional regulator RCCS2:2.492..2.493 Mbp (891 bp) score=40
RCCS2_13119 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RCCS2:2.506..2.507 Mbp (651 bp) score=40
RCCS2_13574 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:2.597..2.598 Mbp (897 bp) score=40
RCCS2_13604 probable transcriptional regulator protein, TetR family COG1309 Transcriptional regulator RCCS2:2.604..2.605 Mbp (591 bp) score=40
RCCS2_13684 transcriptional regulator, LysR family, putative COG0583 Transcriptional regulator RCCS2:2.613..2.614 Mbp (879 bp) score=40
RCCS2_13694 transcriptional regulator, ArsR family, putative COG0640 Predicted transcriptional regulators RCCS2:2.615..2.615 Mbp (324 bp) score=40
RCCS2_13954 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RCCS2:2.66..2.66 Mbp (597 bp) score=40
RCCS2_14524 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:2.76..2.761 Mbp (879 bp) score=40
RCCS2_14534 putative Cro/CI transcriptional regulator COG1396 Predicted transcriptional regulators RCCS2:2.762..2.762 Mbp (372 bp) score=40
RCCS2_14609 transcriptional regulator, BetI COG1309 Transcriptional regulator RCCS2:2.777..2.777 Mbp (570 bp) score=40
RCCS2_14984 transcriptional regulator, MarR family, putative COG1846 Transcriptional regulators RCCS2:2.843..2.843 Mbp (522 bp) score=40
RCCS2_15079 transcriptional regulator, TetR family protein COG1309 Transcriptional regulator RCCS2:2.865..2.866 Mbp (603 bp) score=40
RCCS2_15129 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:2.873..2.874 Mbp (885 bp) score=40
RCCS2_15434 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RCCS2:2.93..2.931 Mbp (744 bp) score=40
RCCS2_15829 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RCCS2:3.007..3.008 Mbp (450 bp) score=40
RCCS2_16164 transcriptional regulator, AsnC family, putative COG1522 Transcriptional regulators RCCS2:3.079..3.08 Mbp (456 bp) score=40
RCCS2_16169 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RCCS2:3.08..3.08 Mbp (453 bp) score=40
RCCS2_16194 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RCCS2:3.084..3.085 Mbp (654 bp) score=40
RCCS2_16376 transcriptional regulator, GntR family protein COG2188 Transcriptional regulators RCCS2:3.119..3.119 Mbp (663 bp) score=40
RCCS2_16716 transcriptional regulator, putative COG2378 Predicted transcriptional regulator RCCS2:3.183..3.183 Mbp (660 bp) score=40
RCCS2_16801 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RCCS2:3.197..3.198 Mbp (378 bp) score=40
RCCS2_17131 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:3.267..3.267 Mbp (903 bp) score=40
RCCS2_17211 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:3.28..3.281 Mbp (906 bp) score=40
RCCS2_17861 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RCCS2:3.397..3.398 Mbp (1.032 kbp) score=40
RCCS2_18136 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator RCCS2:3.452..3.453 Mbp (873 bp) score=40
RCCS2_18156 transcriptional regulator, gntR family, putative COG2186 Transcriptional regulators RCCS2:3.456..3.456 Mbp (735 bp) score=40
RCCS2_00637 two component, sigma54 specific, transcriptional regulator, Fis family protein COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RCCS2:123.4..124.7 kbp (1.338 kbp) score=30
RCCS2_00664 phosphate regulon transcriptional regulatory protein PhoB COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:130.6..131.2 kbp (687 bp) score=30
RCCS2_00824 two component, sigma54 specific, transcriptional regulator, Fis family protein COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RCCS2:163.3..164.7 kbp (1.374 kbp) score=30
RCCS2_02373 transcriptional activator, Baf family, putative COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RCCS2:447.4..448.2 kbp (774 bp) score=30
RCCS2_02835 putative transcription regulator protein COG1309 Transcriptional regulator RCCS2:533.7..534.3 kbp (654 bp) score=30
RCCS2_02935 two component transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:556.3..557 kbp (750 bp) score=30
RCCS2_02980 GntR-family transcription regulator, putative COG1802 Transcriptional regulators RCCS2:561.1..561.7 kbp (648 bp) score=30
RCCS2_03304 putative transcription regulator protein COG0640 Predicted transcriptional regulators RCCS2:618.2..618.6 kbp (330 bp) score=30
RCCS2_04519 proline dehydrogenase transcriptional activator COG1522 Transcriptional regulators RCCS2:852.2..852.7 kbp (492 bp) score=30
RCCS2_05744 proline dehydrogenase transcriptional activator COG1522 Transcriptional regulators RCCS2:1.093..1.093 Mbp (501 bp) score=30
RCCS2_06459 two component transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:1.231..1.232 Mbp (681 bp) score=30
RCCS2_09009 two component transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:1.704..1.705 Mbp (711 bp) score=30
RCCS2_10395 oxidative stress transcription regulator, oxyR, putative COG0583 Transcriptional regulator RCCS2:1.964..1.965 Mbp (903 bp) score=30
RCCS2_11102 transcriptional regulator, Crp/Fnr family protein COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RCCS2:2.108..2.109 Mbp (681 bp) score=30
RCCS2_11127 putative transcription regulator protein COG1846 Transcriptional regulators RCCS2:2.116..2.117 Mbp (468 bp) score=30
RCCS2_11137 two component transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:2.117..2.118 Mbp (663 bp) score=30
RCCS2_12219 Bacterial regulatory proteins, AsnC family:Helix-turn-helix, Fis-type COG1522 Transcriptional regulators RCCS2:2.324..2.324 Mbp (462 bp) score=30
RCCS2_12999 transcription regulator, ROK family FrcR, putative COG1940 Transcriptional regulator/sugar kinase RCCS2:2.481..2.482 Mbp (1.215 kbp) score=30
RCCS2_14224 transcriptional regulator/antitoxin, MazE COG0704 Phosphate uptake regulator RCCS2:2.71..2.71 Mbp (225 bp) score=30
RCCS2_16891 Glutamate uptake regulatory protein, putative COG1522 Transcriptional regulators RCCS2:3.214..3.215 Mbp (462 bp) score=30
RCCS2_17471 redox-sensitive transcriptional activator SoxR COG0789 Predicted transcriptional regulators RCCS2:3.333..3.333 Mbp (444 bp) score=30
RCCS2_18051 C4-dicarboxylate transport transcriptional regulatory protein DctD COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RCCS2:3.436..3.438 Mbp (1.362 kbp) score=30
RCCS2_18331 two component transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:3.493..3.493 Mbp (663 bp) score=30
RCCS2_00187 DNA-binding response regulator CtrA COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:29.01..29.72 kbp (714 bp) score=20
RCCS2_00342 COG1396 Predicted transcriptional regulators RCCS2:65.22..65.86 kbp (645 bp) score=20
RCCS2_00422 autoinducer-binding transcriptional regulator, LuxR family protein RCCS2:82.29..83.05 kbp (765 bp) score=20
RCCS2_00527 transcriptional regulator, SARP family protein RCCS2:103.2..104.6 kbp (1.401 kbp) score=20
RCCS2_00669 phosphate transport system regulatory protein PhoU COG0704 Phosphate uptake regulator RCCS2:131.3..132 kbp (708 bp) score=20
RCCS2_00814 nitrogen assimilation regulatory protein NtrX COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RCCS2:159.5..160.9 kbp (1.404 kbp) score=20
RCCS2_00994 transcriptional regulator, AraC family protein RCCS2:195.6..196.4 kbp (816 bp) score=20
RCCS2_01583 transcriptional regulators, TraR/DksA family protein RCCS2:301..301.5 kbp (423 bp) score=20
RCCS2_01718 DNA-binding response regulator, LuxR family protein COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RCCS2:326..326.6 kbp (633 bp) score=20
RCCS2_02018 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII RCCS2:379..379.3 kbp (339 bp) score=20
RCCS2_02083 transcriptional regulator, LuxR family protein RCCS2:392..392.6 kbp (609 bp) score=20
RCCS2_02088 transcriptional regulator, LuxR family protein RCCS2:392.7..393.2 kbp (489 bp) score=20
RCCS2_03564 COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains RCCS2:664.2..664.7 kbp (474 bp) score=20
RCCS2_04144 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:767.4..768.1 kbp (714 bp) score=20
RCCS2_05029 COG2378 Predicted transcriptional regulator RCCS2:958.3..959 kbp (684 bp) score=20
RCCS2_05114 transcriptional regulator, AraC family protein RCCS2:975.8..976.5 kbp (651 bp) score=20
RCCS2_05794 Crp-Fnr regulatory protein (FnrL) COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RCCS2:1.1..1.101 Mbp (720 bp) score=20
RCCS2_05804 COG1414 Transcriptional regulator RCCS2:1.101..1.102 Mbp (768 bp) score=20
RCCS2_06194 transcriptional regulator, AraC family protein RCCS2:1.186..1.187 Mbp (906 bp) score=20
RCCS2_06479 transcriptional regulator, AraC family protein RCCS2:1.234..1.235 Mbp (834 bp) score=20
RCCS2_06569 COG1476 Predicted transcriptional regulators RCCS2:1.25..1.25 Mbp (207 bp) score=20
RCCS2_06624 response regulator COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RCCS2:1.26..1.26 Mbp (399 bp) score=20
RCCS2_06734 COG1396 Predicted transcriptional regulators RCCS2:1.282..1.283 Mbp (591 bp) score=20
RCCS2_06954 DNA-binding response regulator, putative COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:1.321..1.322 Mbp (687 bp) score=20
RCCS2_07149 COG3423 Predicted transcriptional regulator RCCS2:1.359..1.36 Mbp (165 bp) score=20
RCCS2_07334 nitrogen regulatory protein P-II (GlnB, GlnK) COG0347 Nitrogen regulatory protein PII RCCS2:1.393..1.393 Mbp (339 bp) score=20
RCCS2_07864 COG1940 Transcriptional regulator/sugar kinase RCCS2:1.494..1.495 Mbp (795 bp) score=20
RCCS2_08834 COG1846 Transcriptional regulators RCCS2:1.666..1.667 Mbp (438 bp) score=20
RCCS2_09144 COG1396 Predicted transcriptional regulators RCCS2:1.733..1.733 Mbp (456 bp) score=20
RCCS2_09259 transcriptional regulator, AraC family protein RCCS2:1.753..1.754 Mbp (816 bp) score=20
RCCS2_09479 photosynthetic apparatus regulatory protein RegA COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain RCCS2:1.799..1.8 Mbp (552 bp) score=20
RCCS2_09489 COG0583 Transcriptional regulator RCCS2:1.801..1.803 Mbp (1.557 kbp) score=20
RCCS2_09634 COG1475 Predicted transcriptional regulators RCCS2:1.83..1.831 Mbp (888 bp) score=20
RCCS2_09654 COG1420 Transcriptional regulator of heat shock gene RCCS2:1.834..1.835 Mbp (1.065 kbp) score=20
RCCS2_09864 COG5662 Predicted transmembrane transcriptional regulator (anti-sigma factor) RCCS2:1.878..1.879 Mbp (768 bp) score=20
RCCS2_10310 nitrogen fixation regulatory protein fixK , putative COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RCCS2:1.953..1.954 Mbp (675 bp) score=20
RCCS2_10580 DNA-binding response regulator PetR COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:2.008..2.009 Mbp (702 bp) score=20
RCCS2_11849 COG0789 Predicted transcriptional regulators RCCS2:2.249..2.249 Mbp (240 bp) score=20
RCCS2_11984 COG1733 Predicted transcriptional regulators RCCS2:2.288..2.288 Mbp (372 bp) score=20
RCCS2_12259 transcriptional regulator, AraC family, putative RCCS2:2.331..2.332 Mbp (960 bp) score=20
RCCS2_12419 COG1678 Putative transcriptional regulator RCCS2:2.361..2.361 Mbp (570 bp) score=20
RCCS2_12689 DNA-binding response regulator ChvI, putative COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:2.414..2.415 Mbp (702 bp) score=20
RCCS2_13704 COG0583 Transcriptional regulator RCCS2:2.616..2.617 Mbp (888 bp) score=20
RCCS2_13739 COG2186 Transcriptional regulators RCCS2:2.62..2.621 Mbp (816 bp) score=20
RCCS2_14054 transcriptional regulator, Fur family, putative RCCS2:2.679..2.679 Mbp (345 bp) score=20
RCCS2_14164 transcriptional regulator, LuxR family protein RCCS2:2.699..2.699 Mbp (489 bp) score=20
RCCS2_14324 COG1396 Predicted transcriptional regulators RCCS2:2.727..2.728 Mbp (849 bp) score=20
RCCS2_14369 diguanylate cyclase response regulator COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain RCCS2:2.733..2.735 Mbp (1.329 kbp) score=20
RCCS2_14634 COG1396 Predicted transcriptional regulators RCCS2:2.781..2.783 Mbp (1.401 kbp) score=20
RCCS2_14974 COG1396 Predicted transcriptional regulators RCCS2:2.842..2.842 Mbp (387 bp) score=20
RCCS2_15199 COG1396 Predicted transcriptional regulators RCCS2:2.894..2.894 Mbp (348 bp) score=20
RCCS2_16281 COG1940 Transcriptional regulator/sugar kinase RCCS2:3.099..3.1 Mbp (1.266 kbp) score=20
RCCS2_16546 transcriptional regulator, AraC family protein RCCS2:3.15..3.151 Mbp (867 bp) score=20
RCCS2_17611 COG1396 Predicted transcriptional regulators RCCS2:3.356..3.356 Mbp (330 bp) score=20
RCCS2_17926 COG1349 Transcriptional regulators of sugar metabolism RCCS2:3.411..3.412 Mbp (759 bp) score=20
RCCS2_01024 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RCCS2:203.9..204.5 kbp (618 bp) score=10
RCCS2_01748 COG0440 Acetolactate synthase, small (regulatory) subunit RCCS2:332.4..333 kbp (567 bp) score=10
RCCS2_02523 Response regulator containing a CheY-like receiver domain and a GGDEF domain RCCS2:470.4..471.9 kbp (1.434 kbp) score=10
RCCS2_03212 response regulator RCCS2:604.1..604.5 kbp (369 bp) score=10
RCCS2_04234 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RCCS2:787.6..789.2 kbp (1.623 kbp) score=10
RCCS2_05054 methanol dehydrogenase regulator moxR, putative RCCS2:961.5..962.5 kbp (1.008 kbp) score=10
RCCS2_05344 two-component hybrid sensor and regulator RCCS2:1.018..1.019 Mbp (1.365 kbp) score=10
RCCS2_05424 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RCCS2:1.034..1.035 Mbp (774 bp) score=10
RCCS2_05879 ATP phosphoribosyltransferase regulatory subunit RCCS2:1.117..1.118 Mbp (1.08 kbp) score=10
RCCS2_08839 transcriptional antitermination protein, putative RCCS2:1.667..1.668 Mbp (519 bp) score=10
RCCS2_09014 sensory box histidine kinase/response regulator RCCS2:1.705..1.707 Mbp (1.929 kbp) score=10
RCCS2_09139 regulatory protein RCCS2:1.732..1.733 Mbp (666 bp) score=10
RCCS2_09949 PTS IIA-like nitrogen-regulatory protein PtsN RCCS2:1.898..1.899 Mbp (465 bp) score=10
RCCS2_10215 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RCCS2:1.939..1.939 Mbp (753 bp) score=10
RCCS2_10290 response regulator receiver protein RCCS2:1.951..1.951 Mbp (810 bp) score=10
RCCS2_10685 response regulator receiver domain protein (CheY-like) RCCS2:2.028..2.029 Mbp (654 bp) score=10
RCCS2_12539 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RCCS2:2.382..2.384 Mbp (1.998 kbp) score=10
RCCS2_12969 putative ferric uptake regulator, FUR family protein RCCS2:2.476..2.476 Mbp (498 bp) score=10
RCCS2_13749 ADA regulatory protein RCCS2:2.622..2.623 Mbp (849 bp) score=10
RCCS2_14484 COG3023 Negative regulator of beta-lactamase expression RCCS2:2.755..2.756 Mbp (750 bp) score=10
RCCS2_14814 LuxR-type transcription regulator required for testosterone degradation RCCS2:2.817..2.818 Mbp (975 bp) score=10
RCCS2_15774 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RCCS2:2.995..2.995 Mbp (477 bp) score=10
RCCS2_15789 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RCCS2:2.997..2.998 Mbp (741 bp) score=10
RCCS2_16621 Response regulator receiver RCCS2:3.169..3.169 Mbp (375 bp) score=10
RCCS2_16641 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RCCS2:3.171..3.172 Mbp (798 bp) score=10
RCCS2_17291 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) RCCS2:3.298..3.298 Mbp (687 bp) score=10
RCCS2_17426 ferric uptake regulator, FUR family protein RCCS2:3.325..3.326 Mbp (420 bp) score=10
RCCS2_18066 COG0425 Predicted redox protein, regulator of disulfide bond formation RCCS2:3.442..3.442 Mbp (228 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70