Roseobase: Rhodobacterales bacterium HTCC2150

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RB2150:3100000..3200000, RB2150_17494, RB2150_t17772, anmK, ZP_01743778, transcriptional regulators, AISAQVNGEHFDLAWPIENDASI AINTMKETGPALELIRHDFAHVMARAVQAL.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 160 regions match your request.
Matches on RB2150
overview_RB2150
RB2150_00005 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RB2150:1..525 bp (525 bp) score=30
RB2150_00390 Cu(I)-responsive transcriptional regulator COG0789 Predicted transcriptional regulators RB2150:68.62..69.01 kbp (396 bp) score=30
RB2150_00684 transcriptional regulator, putative COG1396 Predicted transcriptional regulators RB2150:124..125.2 kbp (1.275 kbp) score=30
RB2150_01294 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RB2150:236.5..237 kbp (462 bp) score=30
RB2150_01394 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RB2150:254.9..255.4 kbp (429 bp) score=30
RB2150_02739 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RB2150:531.8..532.5 kbp (660 bp) score=30
RB2150_03304 hypothetical transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RB2150:639..639.4 kbp (318 bp) score=30
RB2150_03534 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RB2150:684.1..685 kbp (927 bp) score=30
RB2150_04633 putative transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RB2150:883.6..884 kbp (342 bp) score=30
RB2150_04813 transcriptional regulator, GntR family protein COG2188 Transcriptional regulators RB2150:923.8..924.5 kbp (711 bp) score=30
RB2150_05198 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RB2150:1.008..1.008 Mbp (642 bp) score=30
RB2150_05218 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RB2150:1.011..1.012 Mbp (456 bp) score=30
RB2150_05223 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RB2150:1.012..1.012 Mbp (456 bp) score=30
RB2150_05388 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:1.044..1.045 Mbp (432 bp) score=30
RB2150_05638 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:1.091..1.092 Mbp (498 bp) score=30
RB2150_06978 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:1.354..1.355 Mbp (435 bp) score=30
RB2150_07388 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RB2150:1.433..1.434 Mbp (660 bp) score=30
RB2150_08689 transcriptional regulator SoxR COG0640 Predicted transcriptional regulators RB2150:1.673..1.674 Mbp (336 bp) score=30
RB2150_09054 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RB2150:1.742..1.743 Mbp (1.02 kbp) score=30
RB2150_09609 Putative transcriptional regulator COG1733 Predicted transcriptional regulators RB2150:1.841..1.842 Mbp (420 bp) score=30
RB2150_09954 transcriptional regulatory protein COG1802 Transcriptional regulators RB2150:1.902..1.902 Mbp (663 bp) score=30
RB2150_10084 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RB2150:1.933..1.933 Mbp (327 bp) score=30
RB2150_10134 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:1.94..1.94 Mbp (507 bp) score=30
RB2150_10224 LacI family transcriptional repressor COG1609 Transcriptional regulators RB2150:1.961..1.962 Mbp (1.041 kbp) score=30
RB2150_12121 transcriptional regulator COG1846 Transcriptional regulators RB2150:2.383..2.384 Mbp (459 bp) score=30
RB2150_12326 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:2.428..2.428 Mbp (444 bp) score=30
RB2150_12711 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RB2150:2.51..2.511 Mbp (1.023 kbp) score=30
RB2150_12871 transcriptional regulator NanR COG2186 Transcriptional regulators RB2150:2.541..2.542 Mbp (732 bp) score=30
RB2150_13451 putative transcriptional regulator, asnC family protein COG1522 Transcriptional regulators RB2150:2.671..2.672 Mbp (426 bp) score=30
RB2150_13846 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:2.736..2.737 Mbp (441 bp) score=30
RB2150_13956 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators RB2150:2.749..2.75 Mbp (345 bp) score=30
RB2150_14756 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RB2150:2.913..2.913 Mbp (459 bp) score=30
RB2150_14966 Proline dehydrogenase transcriptional activator COG1522 Transcriptional regulators RB2150:2.951..2.952 Mbp (501 bp) score=30
RB2150_15186 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RB2150:2.993..2.994 Mbp (384 bp) score=30
RB2150_15191 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators RB2150:2.994..2.994 Mbp (369 bp) score=30
RB2150_15446 transcriptional regulator COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RB2150:3.045..3.046 Mbp (1.452 kbp) score=30
RB2150_16447 putative CarD-like transcriptional regulator COG1329 Transcriptional regulators, similar to M. xanthus CarD RB2150:3.221..3.221 Mbp (519 bp) score=30
RB2150_16472 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RB2150:3.227..3.227 Mbp (459 bp) score=30
RB2150_17184 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:3.363..3.363 Mbp (501 bp) score=30
RB2150_17354 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators RB2150:3.391..3.392 Mbp (879 bp) score=30
RB2150_18172 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators RB2150:3.544..3.544 Mbp (531 bp) score=30
RB2150_18217 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RB2150:3.551..3.552 Mbp (1.005 kbp) score=30
RB2150_18227 transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators RB2150:3.555..3.556 Mbp (579 bp) score=30
RB2150_18257 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators RB2150:3.56..3.561 Mbp (906 bp) score=30
RB2150_18352 transcriptional regulatory protein COG1802 Transcriptional regulators RB2150:3.575..3.576 Mbp (636 bp) score=30
RB2150_01019 Putative transcriptional regulator COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RB2150:186.3..187 kbp (771 bp) score=20
RB2150_02339 COG1396 Predicted transcriptional regulators RB2150:448.3..448.9 kbp (624 bp) score=20
RB2150_02644 transcriptional regulator, BadM/Rrf2 family protein COG1959 Predicted transcriptional regulator RB2150:513.7..514.3 kbp (543 bp) score=20
RB2150_03554 Predicted transcriptional regulator containing the HTH domain COG1386 Predicted transcriptional regulator containing the HTH domain RB2150:688.1..688.7 kbp (651 bp) score=20
RB2150_03978 COG1396 Predicted transcriptional regulators RB2150:763.3..764.9 kbp (1.617 kbp) score=20
RB2150_05928 transcriptional regulator, BadM/Rrf2 family protein COG1959 Predicted transcriptional regulator RB2150:1.143..1.143 Mbp (324 bp) score=20
RB2150_06493 COG1522 Transcriptional regulators RB2150:1.266..1.266 Mbp (462 bp) score=20
RB2150_06538 COG0640 Predicted transcriptional regulators RB2150:1.273..1.273 Mbp (327 bp) score=20
RB2150_07348 COG1396 Predicted transcriptional regulators RB2150:1.422..1.423 Mbp (447 bp) score=20
RB2150_07663 COG1396 Predicted transcriptional regulators RB2150:1.484..1.485 Mbp (393 bp) score=20
RB2150_07703 COG1396 Predicted transcriptional regulators RB2150:1.493..1.494 Mbp (576 bp) score=20
RB2150_07983 COG1609 Transcriptional regulators RB2150:1.54..1.541 Mbp (1.047 kbp) score=20
RB2150_08739 COG1475 Predicted transcriptional regulators RB2150:1.682..1.683 Mbp (1.113 kbp) score=20
RB2150_09379 COG1396 Predicted transcriptional regulators RB2150:1.8..1.8 Mbp (588 bp) score=20
RB2150_09554 COG1349 Transcriptional regulators of sugar metabolism RB2150:1.83..1.83 Mbp (780 bp) score=20
RB2150_09739 COG1396 Predicted transcriptional regulators RB2150:1.864..1.864 Mbp (279 bp) score=20
RB2150_10716 COG1396 Predicted transcriptional regulators RB2150:2.051..2.052 Mbp (636 bp) score=20
RB2150_10741 two component transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:2.058..2.059 Mbp (777 bp) score=20
RB2150_11016 two component transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:2.111..2.111 Mbp (687 bp) score=20
RB2150_11351 COG1475 Predicted transcriptional regulators RB2150:2.224..2.224 Mbp (402 bp) score=20
RB2150_11371 COG1737 Transcriptional regulators RB2150:2.229..2.23 Mbp (888 bp) score=20
RB2150_11416 COG1396 Predicted transcriptional regulators RB2150:2.239..2.239 Mbp (600 bp) score=20
RB2150_11841 COG1475 Predicted transcriptional regulators RB2150:2.329..2.329 Mbp (912 bp) score=20
RB2150_13986 COG2186 Transcriptional regulators RB2150:2.753..2.753 Mbp (768 bp) score=20
RB2150_15356 COG1846 Transcriptional regulators RB2150:3.024..3.024 Mbp (456 bp) score=20
RB2150_15980 transcriptional regulator, BadM/Rrf2 family protein COG1959 Predicted transcriptional regulator RB2150:3.138..3.139 Mbp (324 bp) score=20
RB2150_16187 COG1396 Predicted transcriptional regulators RB2150:3.171..3.172 Mbp (1.398 kbp) score=20
RB2150_16584 COG1396 Predicted transcriptional regulators RB2150:3.242..3.242 Mbp (369 bp) score=20
RB2150_17887 COG1475 Predicted transcriptional regulators RB2150:3.483..3.484 Mbp (1.092 kbp) score=20
RB2150_18032 COG1475 Predicted transcriptional regulators RB2150:3.515..3.516 Mbp (1.002 kbp) score=20
RB2150_00010 transcriptional regulator, TetR family protein RB2150:787 bp..1.392 kbp (606 bp) score=10
RB2150_00305 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:50.91..51.64 kbp (729 bp) score=10
RB2150_00442 transcriptional regulator, TetR family protein RB2150:78.83..79.41 kbp (582 bp) score=10
RB2150_00487 COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains RB2150:87.39..87.86 kbp (468 bp) score=10
RB2150_00522 transcriptional regulator, LysR family protein RB2150:95.25..96.14 kbp (891 bp) score=10
RB2150_00689 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:125.3..125.7 kbp (369 bp) score=10
RB2150_01054 COG2378 Predicted transcriptional regulator RB2150:195.8..196.5 kbp (678 bp) score=10
RB2150_01174 transcriptional regulator, TetR family protein RB2150:216..216.6 kbp (612 bp) score=10
RB2150_01544 transcriptional regulator, LysR family protein RB2150:290.4..291.3 kbp (900 bp) score=10
RB2150_01609 transcriptional regulator, LysR family protein RB2150:302.6..303.5 kbp (903 bp) score=10
RB2150_01679 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) RB2150:319.5..320.2 kbp (699 bp) score=10
RB2150_01999 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:381.6..382.3 kbp (714 bp) score=10
RB2150_02174 transcriptional regulator, AraC family protein RB2150:417.1..418.1 kbp (1.005 kbp) score=10
RB2150_02239 autoinducer-binding transcriptional regulator, LuxR family protein RB2150:428.7..429.5 kbp (822 bp) score=10
RB2150_02299 transcriptional regulator RB2150:442.1..443 kbp (915 bp) score=10
RB2150_02889 transcriptional regulator, LysR family protein RB2150:555.3..556.2 kbp (912 bp) score=10
RB2150_02979 two component, sigma54 specific, transcriptional regulator, Fis family protein RB2150:579.1..580.5 kbp (1.368 kbp) score=10
RB2150_03149 transcriptional regulator, TetR family protein RB2150:607.9..608.6 kbp (621 bp) score=10
RB2150_03229 transcriptional regulator, AraC family protein RB2150:621.7..622.5 kbp (816 bp) score=10
RB2150_03324 transcriptional regulator, LysR family protein RB2150:645.3..646.2 kbp (885 bp) score=10
RB2150_03728 transcriptional regulator RB2150:718.6..719.2 kbp (546 bp) score=10
RB2150_03768 two component, sigma54 specific transcriptional regulator, fis family protein RB2150:725.6..726.9 kbp (1.329 kbp) score=10
RB2150_04378 transcriptional regulator, LysR family protein RB2150:832.9..833.8 kbp (909 bp) score=10
RB2150_04408 probable transcriptional regulator protein, TetR family RB2150:839.7..840.4 kbp (708 bp) score=10
RB2150_05508 transcriptional regulator, LysR family protein RB2150:1.068..1.069 Mbp (963 bp) score=10
RB2150_05818 transcriptional regulator, LysR family protein RB2150:1.124..1.125 Mbp (918 bp) score=10
RB2150_05833 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:1.127..1.128 Mbp (669 bp) score=10
RB2150_06223 COG3327 Phenylacetic acid-responsive transcriptional repressor RB2150:1.202..1.203 Mbp (807 bp) score=10
RB2150_07763 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:1.502..1.503 Mbp (705 bp) score=10
RB2150_08233 transcriptional regulator, LysR family protein RB2150:1.587..1.588 Mbp (900 bp) score=10
RB2150_08343 transcriptional regulator, TetR family protein RB2150:1.609..1.609 Mbp (642 bp) score=10
RB2150_08378 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:1.619..1.62 Mbp (1.437 kbp) score=10
RB2150_08423 transcriptional regulator, ROK family protein RB2150:1.626..1.628 Mbp (1.248 kbp) score=10
RB2150_08483 C4-dicarboxylate transport transcriptional regulatory protein DctD RB2150:1.641..1.642 Mbp (1.338 kbp) score=10
RB2150_08518 transcriptional regulator, LysR family protein RB2150:1.652..1.653 Mbp (879 bp) score=10
RB2150_08618 transcriptional regulator RB2150:1.667..1.668 Mbp (903 bp) score=10
RB2150_08633 transcriptional regulator, TetR family protein RB2150:1.669..1.67 Mbp (606 bp) score=10
RB2150_08699 transcriptional regulator, LysR family protein RB2150:1.675..1.676 Mbp (759 bp) score=10
RB2150_08734 transcriptional regulator, LysR family protein RB2150:1.681..1.682 Mbp (927 bp) score=10
RB2150_08794 COG3629 DNA-binding transcriptional activator of the SARP family RB2150:1.692..1.694 Mbp (1.959 kbp) score=10
RB2150_08809 two component transcriptional regulator, LuxR family protein RB2150:1.698..1.699 Mbp (699 bp) score=10
RB2150_09269 transcriptional regulator, LysR family protein RB2150:1.78..1.781 Mbp (696 bp) score=10
RB2150_09549 DNA-binding transcriptional repressor RB2150:1.829..1.83 Mbp (381 bp) score=10
RB2150_09644 transcriptional regulator, LysR family protein RB2150:1.848..1.849 Mbp (870 bp) score=10
RB2150_09674 LysR-family transcriptional regulator RB2150:1.853..1.854 Mbp (903 bp) score=10
RB2150_09799 transcriptional activator, putative RB2150:1.873..1.874 Mbp (648 bp) score=10
RB2150_09969 transcriptional regulator, AraC family protein RB2150:1.911..1.912 Mbp (951 bp) score=10
RB2150_10129 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:1.939..1.94 Mbp (702 bp) score=10
RB2150_10189 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:1.954..1.956 Mbp (1.437 kbp) score=10
RB2150_10379 negative transcriptional regulator RB2150:1.991..1.991 Mbp (627 bp) score=10
RB2150_10384 COG1678 Putative transcriptional regulator RB2150:1.991..1.992 Mbp (576 bp) score=10
RB2150_10791 transcriptional regulator, IclR family protein RB2150:2.07..2.07 Mbp (759 bp) score=10
RB2150_11261 transcriptional regulator RB2150:2.163..2.164 Mbp (843 bp) score=10
RB2150_11276 possible transcriptional activator RB2150:2.167..2.168 Mbp (471 bp) score=10
RB2150_11281 transcriptional regulator, LuxR family protein RB2150:2.168..2.168 Mbp (612 bp) score=10
RB2150_11286 transcriptional regulator, LuxR family protein RB2150:2.168..2.169 Mbp (717 bp) score=10
RB2150_11661 transcriptional regulator, LysR family protein RB2150:2.293..2.294 Mbp (900 bp) score=10
RB2150_12556 transcriptional regulator protein, AraC family RB2150:2.476..2.477 Mbp (960 bp) score=10
RB2150_12781 transcriptional regulator, IclR family protein RB2150:2.524..2.525 Mbp (780 bp) score=10
RB2150_12866 transcriptional regulator NanR RB2150:2.541..2.541 Mbp (177 bp) score=10
RB2150_12926 transcriptional regulator RB2150:2.553..2.555 Mbp (1.911 kbp) score=10
RB2150_13011 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:2.571..2.571 Mbp (705 bp) score=10
RB2150_13951 transcriptional regulator, LysR family protein RB2150:2.748..2.749 Mbp (879 bp) score=10
RB2150_14426 autoinducer-binding transcriptional regulator LuxR RB2150:2.849..2.85 Mbp (681 bp) score=10
RB2150_14521 two component, sigma54 specific, transcriptional regulator, Fis family protein RB2150:2.868..2.87 Mbp (1.356 kbp) score=10
RB2150_14831 transcriptional regulator MetR RB2150:2.924..2.925 Mbp (918 bp) score=10
RB2150_15066 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2150:2.97..2.97 Mbp (921 bp) score=10
RB2150_15920 transcriptional regulator, TetR family protein RB2150:3.127..3.128 Mbp (612 bp) score=10
RB2150_15950 COG3311 Predicted transcriptional regulator RB2150:3.134..3.134 Mbp (198 bp) score=10
RB2150_16032 transcriptional regulator, LysR family protein RB2150:3.147..3.147 Mbp (900 bp) score=10
RB2150_16564 transcriptional regulator, LysR family protein RB2150:3.239..3.24 Mbp (852 bp) score=10
RB2150_16679 transcriptional regulator BetI RB2150:3.26..3.26 Mbp (582 bp) score=10
RB2150_17074 transcriptional regulator, LysR family protein RB2150:3.343..3.344 Mbp (951 bp) score=10
RB2150_17104 transcriptional regulator, LysR family protein RB2150:3.349..3.35 Mbp (906 bp) score=10
RB2150_17424 transcriptional regulator, TetR family protein RB2150:3.406..3.407 Mbp (645 bp) score=10
RB2150_17669 COG3311 Predicted transcriptional regulator RB2150:3.451..3.451 Mbp (207 bp) score=10
RB2150_17684 transcriptional regulator, LysR family protein RB2150:3.453..3.454 Mbp (897 bp) score=10
RB2150_17734 probable transcriptional regulator protein, AraC family RB2150:3.462..3.463 Mbp (822 bp) score=10
RB2150_17867 DNA-binding transcriptional dual regulator RB2150:3.479..3.48 Mbp (882 bp) score=10
RB2150_17877 transcriptional regulator RB2150:3.481..3.482 Mbp (888 bp) score=10
RB2150_17912 transcriptional regulator, TetR family protein RB2150:3.49..3.49 Mbp (651 bp) score=10
RB2150_17972 probable transcriptional regulator protein, AraC family RB2150:3.501..3.502 Mbp (873 bp) score=10
RB2150_18132 transcriptional regulator, LysR family protein RB2150:3.536..3.537 Mbp (891 bp) score=10
RB2150_18157 transcriptional regulator, IclR family protein RB2150:3.54..3.541 Mbp (822 bp) score=10
RB2150_18222 fused DNA-binding transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase RB2150:3.552..3.555 Mbp (3.45 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70