Roseobase: Rhodobacterales bacterium HTCC2083

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RB2083:3100000..3200000, RB2083_3440, bhbD, ZP_05075835, transcriptional regulator, IVGFGTSGVTENNWILEDVGPIHNNTMPTMTEIQPGQLVRI.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 398 regions match your request.
Matches on RB2083
overview_RB2083
RB2083_26 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RB2083:2.244..2.859 kbp (616 bp) score=40
RB2083_15 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:8.576..9.169 kbp (594 bp) score=40
RB2083_3291 putative TetR-family transcriptional regulator [K] COG1309 Transcriptional regulator RB2083:86.15..86.69 kbp (546 bp) score=40
RB2083_3907 transcriptional regulator, GntR family, putative [KE] COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RB2083:125.4..126.8 kbp (1.386 kbp) score=40
RB2083_3419 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:160.7..161.6 kbp (888 bp) score=40
RB2083_3867 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RB2083:214.8..215.5 kbp (651 bp) score=40
RB2083_3560 transcriptional regulator SoxR [K] COG0640 Predicted transcriptional regulators RB2083:238.1..238.4 kbp (294 bp) score=40
RB2083_2697 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:240.1..241 kbp (879 bp) score=40
RB2083_1573 transcriptional regulator, XRE family with cupin sensor domain [K] COG1396 Predicted transcriptional regulators RB2083:256.9..257.6 kbp (618 bp) score=40
RB2083_2514 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:336.7..337.1 kbp (474 bp) score=40
RB2083_574 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RB2083:343.5..344.3 kbp (759 bp) score=40
RB2083_466 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:344.4..345.4 kbp (912 bp) score=40
RB2083_1241 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:368.5..369.4 kbp (885 bp) score=40
RB2083_429 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:371.3..371.5 kbp (180 bp) score=40
RB2083_1454 transcriptional regulator, BadM/Rrf2 family [K] COG1959 Predicted transcriptional regulator RB2083:391.9..392.2 kbp (345 bp) score=40
RB2083_3049 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RB2083:608.9..609.3 kbp (462 bp) score=40
RB2083_3828 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RB2083:696.1..696.4 kbp (324 bp) score=40
RB2083_3166 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:709.2..710.1 kbp (882 bp) score=40
RB2083_3317 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RB2083:726.5..727.1 kbp (612 bp) score=40
RB2083_2286 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RB2083:727.5..728.2 kbp (651 bp) score=40
RB2083_3386 transcriptional regulatory protein [K] COG1733 Predicted transcriptional regulators RB2083:728.2..728.6 kbp (366 bp) score=40
RB2083_1216 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:742.9..743.8 kbp (897 bp) score=40
RB2083_3444 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RB2083:755.4..756.1 kbp (699 bp) score=40
RB2083_1137 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:791.5..792.2 kbp (678 bp) score=40
RB2083_1052 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:810.7..811.6 kbp (888 bp) score=40
marR transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:855.9..856.4 kbp (507 bp) score=40
RB2083_1142 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:865.2..866.1 kbp (909 bp) score=40
RB2083_1456 transcriptional regulator, BadM/Rrf2 family [K] COG1959 Predicted transcriptional regulator RB2083:946.1..946.5 kbp (429 bp) score=40
RB2083_1495 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:969..969.9 kbp (906 bp) score=40
RB2083_1800 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RB2083:979.3..980.2 kbp (837 bp) score=40
RB2083_1493 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:1.034..1.035 Mbp (1.026 kbp) score=40
RB2083_739 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:1.079..1.08 Mbp (930 bp) score=40
RB2083_337 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RB2083:1.176..1.176 Mbp (747 bp) score=40
RB2083_3481 regulatory protein, GntR:Bacterial regulatory protein, GntR [K] COG2186 Transcriptional regulators RB2083:1.179..1.18 Mbp (660 bp) score=40
RB2083_2810 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:1.237..1.238 Mbp (441 bp) score=40
RB2083_1720 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RB2083:1.395..1.396 Mbp (795 bp) score=40
RB2083_1446 transcriptional regulator, TetR family protein [K] COG1309 Transcriptional regulator RB2083:1.419..1.42 Mbp (597 bp) score=40
RB2083_1558 negative transcriptional regulator [K] COG2808 Transcriptional regulator RB2083:1.433..1.434 Mbp (630 bp) score=40
RB2083_609 transcriptional regulator, TetR family protein [K] COG1309 Transcriptional regulator RB2083:1.449..1.45 Mbp (561 bp) score=40
RB2083_1557 transcriptional regulator, putative [K] COG1959 Predicted transcriptional regulator RB2083:1.534..1.534 Mbp (333 bp) score=40
RB2083_1736 transcriptional regulator, TetR family, putative [K] COG1309 Transcriptional regulator RB2083:1.6..1.601 Mbp (540 bp) score=40
RB2083_280 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RB2083:1.618..1.619 Mbp (642 bp) score=40
RB2083_3833 transcriptional regulator, GntR family [K] COG2188 Transcriptional regulators RB2083:1.633..1.633 Mbp (648 bp) score=40
RB2083_3149 transcriptional regulatory protein [K] COG1733 Predicted transcriptional regulators RB2083:1.64..1.64 Mbp (396 bp) score=40
RB2083_1538 transcriptional regulator, TetR family protein [K] COG1309 Transcriptional regulator RB2083:1.642..1.643 Mbp (633 bp) score=40
RB2083_3842 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:1.649..1.65 Mbp (966 bp) score=40
RB2083_2580 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:1.676..1.676 Mbp (372 bp) score=40
RB2083_2275 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:1.676..1.677 Mbp (402 bp) score=40
RB2083_3178 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:1.755..1.755 Mbp (543 bp) score=40
RB2083_1019 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RB2083:1.775..1.775 Mbp (528 bp) score=40
RB2083_3005 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RB2083:1.954..1.954 Mbp (408 bp) score=40
RB2083_2637 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RB2083:1.955..1.955 Mbp (369 bp) score=40
RB2083_1501 transcriptional regulatory protein [K] COG1733 Predicted transcriptional regulators RB2083:1.998..1.999 Mbp (396 bp) score=40
RB2083_4012 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:2.015..2.015 Mbp (861 bp) score=40
RB2083_106 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:2.068..2.068 Mbp (666 bp) score=40
RB2083_2214 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:2.079..2.08 Mbp (906 bp) score=40
RB2083_3408 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator; overlaps another CDS with the same product name RB2083:2.084..2.085 Mbp (216 bp) score=40
RB2083_4122 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator; overlaps another CDS with the same product name RB2083:2.085..2.085 Mbp (351 bp) score=40
RB2083_2821 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:2.1..2.101 Mbp (1.233 kbp) score=40
RB2083_1048 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:2.107..2.107 Mbp (483 bp) score=40
RB2083_772 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:2.121..2.121 Mbp (483 bp) score=40
RB2083_2301 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:2.286..2.287 Mbp (1.029 kbp) score=40
RB2083_1644 transcriptional regulator, CarD family [K] COG1329 Transcriptional regulators, similar to M. xanthus CarD RB2083:2.314..2.314 Mbp (519 bp) score=40
RB2083_3340 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RB2083:2.318..2.319 Mbp (456 bp) score=40
RB2083_1788 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:2.338..2.339 Mbp (960 bp) score=40
RB2083_46 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:2.366..2.367 Mbp (1.035 kbp) score=40
RB2083_659 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RB2083:2.433..2.434 Mbp (420 bp) score=40
RB2083_2172 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RB2083:2.434..2.434 Mbp (459 bp) score=40
RB2083_1081 transcriptional regulatory protein [K] COG1414 Transcriptional regulator RB2083:2.457..2.458 Mbp (792 bp) score=40
cueR Cu(I)-responsive transcriptional regulator [K] COG0789 Predicted transcriptional regulators RB2083:2.469..2.469 Mbp (384 bp) score=40
RB2083_3081 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:2.474..2.475 Mbp (885 bp) score=40
RB2083_1844 putative transcriptional regulator [K] COG1609 Transcriptional regulators RB2083:2.497..2.498 Mbp (1.053 kbp) score=40
metR transcriptional regulator MetR [K] COG0583 Transcriptional regulator RB2083:2.535..2.536 Mbp (966 bp) score=40
RB2083_1466 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:2.546..2.547 Mbp (1.047 kbp) score=40
RB2083_1379 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:2.715..2.716 Mbp (375 bp) score=40
RB2083_627 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:2.774..2.776 Mbp (1.02 kbp) score=40
RB2083_2859 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:2.792..2.792 Mbp (591 bp) score=40
RB2083_509 transcriptional regulator, XRE family with cupin sensor domain [K] COG1396 Predicted transcriptional regulators RB2083:2.854..2.855 Mbp (573 bp) score=40
RB2083_282 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:2.857..2.858 Mbp (996 bp) score=40
RB2083_2291 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:2.872..2.872 Mbp (348 bp) score=40
RB2083_3859 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RB2083:2.894..2.895 Mbp (708 bp) score=40
RB2083_1983 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RB2083:2.905..2.905 Mbp (567 bp) score=40
RB2083_3622 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RB2083:2.931..2.931 Mbp (489 bp) score=40
RB2083_258 transcriptional regulator, LysR family, putative [K] COG0583 Transcriptional regulator RB2083:2.945..2.946 Mbp (900 bp) score=40
RB2083_3123 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RB2083:2.957..2.958 Mbp (783 bp) score=40
RB2083_1794 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RB2083:2.966..2.967 Mbp (786 bp) score=40
RB2083_3530 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:3.021..3.022 Mbp (843 bp) score=40
RB2083_3509 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RB2083:3.03..3.031 Mbp (783 bp) score=40
RB2083_164 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RB2083:3.107..3.107 Mbp (423 bp) score=40
RB2083_3927 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:3.123..3.124 Mbp (906 bp) score=40
RB2083_65 HTH-type transcriptional regulator NsrR [K] COG1959 Predicted transcriptional regulator RB2083:3.134..3.135 Mbp (348 bp) score=40
RB2083_764 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:3.183..3.184 Mbp (852 bp) score=40
RB2083_1727 transcriptional regulator, LysR family protein [K] COG0583 Transcriptional regulator RB2083:3.238..3.238 Mbp (810 bp) score=40
RB2083_2855 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RB2083:3.276..3.277 Mbp (402 bp) score=40
RB2083_433 transcriptional regulator, GntR family [K] COG1725 Predicted transcriptional regulators RB2083:3.309..3.311 Mbp (1.422 kbp) score=40
RB2083_1476 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:3.318..3.319 Mbp (624 bp) score=40
RB2083_174 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:3.336..3.337 Mbp (918 bp) score=40
RB2083_1281 transcriptional regulator [K] COG1522 Transcriptional regulators RB2083:3.366..3.366 Mbp (456 bp) score=40
RB2083_369 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:3.406..3.407 Mbp (1.005 kbp) score=40
RB2083_2483 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RB2083:3.588..3.589 Mbp (717 bp) score=40
RB2083_261 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:3.659..3.66 Mbp (582 bp) score=40
RB2083_891 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RB2083:3.742..3.742 Mbp (240 bp) score=40
RB2083_3464 transcriptional regulator, LysR-family, putative [K] COG0583 Transcriptional regulator RB2083:3.759..3.76 Mbp (564 bp) score=40
RB2083_3177 transcriptional regulator, GntR family [K] COG2188 Transcriptional regulators RB2083:3.798..3.799 Mbp (702 bp) score=40
RB2083_56 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RB2083:3.809..3.81 Mbp (894 bp) score=40
RB2083_1480 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:3.822..3.823 Mbp (891 bp) score=40
RB2083_3066 transcriptional regulator, RpiR family [K] COG1737 Transcriptional regulators RB2083:3.857..3.858 Mbp (846 bp) score=40
RB2083_3820 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:3.868..3.868 Mbp (864 bp) score=40
RB2083_1774 LysR family transcriptional regulatory protein [K] COG0583 Transcriptional regulator RB2083:3.878..3.879 Mbp (981 bp) score=40
RB2083_4093 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RB2083:3.896..3.897 Mbp (996 bp) score=40
RB2083_3097 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RB2083:3.913..3.913 Mbp (510 bp) score=40
RB2083_2650 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RB2083:3.914..3.914 Mbp (438 bp) score=40
RB2083_2265 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RB2083:3.954..3.955 Mbp (1.401 kbp) score=40
RB2083_2475 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RB2083:3.976..3.977 Mbp (408 bp) score=40
RB2083_3377 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:3.979..3.979 Mbp (621 bp) score=40
RB2083_3294 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RB2083:3.979..3.98 Mbp (897 bp) score=40
RB2083_2259 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RB2083:3.984..3.985 Mbp (624 bp) score=40
RB2083_2368 sigma54 specific transcriptional regulator, Fis family [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RB2083:446.5..447.6 kbp (1.101 kbp) score=30
flcA two component transcriptional regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RB2083:469.2..469.8 kbp (645 bp) score=30
RB2083_2927 isoleucine biosynthesis transcriptional activator IlvR, putative [K] COG0583 Transcriptional regulator RB2083:882.6..883.4 kbp (771 bp) score=30
hpaR homoprotocatechuate degradation operon regulator, HpaR [K] COG1846 Transcriptional regulators RB2083:955..955.5 kbp (492 bp) score=30
RB2083_1038 transcriptional regulatory protein [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RB2083:1.076..1.078 Mbp (1.851 kbp) score=30
RB2083_206 regulatory protein, TetR [K] COG1309 Transcriptional regulator RB2083:1.378..1.379 Mbp (600 bp) score=30
RB2083_2494 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:1.438..1.439 Mbp (705 bp) score=30
soxR redox-sensitive transcriptional activator SoxR [K] COG0789 Predicted transcriptional regulators RB2083:1.499..1.499 Mbp (453 bp) score=30
RB2083_1942 transcriptional regulator, Crp/Fnr family [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RB2083:1.683..1.684 Mbp (639 bp) score=30
RB2083_3605 transcriptional regulator, LytR/AlgR family [KT] COG3279 Response regulator of the LytR/AlgR family RB2083:2.446..2.447 Mbp (777 bp) score=30
grp glutamate uptake regulatory protein [K] COG1522 Transcriptional regulators RB2083:2.761..2.762 Mbp (462 bp) score=30
stc transcriptional regulator [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RB2083:2.912..2.914 Mbp (1.926 kbp) score=30
dctD C4-dicarboxylate transport transcriptional regulatory protein DctD [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RB2083:3.103..3.105 Mbp (1.335 kbp) score=30
RB2083_1776 autoinducer-binding transcriptional regulator, LuxR family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:3.333..3.334 Mbp (756 bp) score=30
phoB phosphate regulon transcriptional regulatory protein PhoB [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:3.337..3.338 Mbp (684 bp) score=30
pobR transcriptional regulator, AraC family [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain RB2083:3.481..3.482 Mbp (834 bp) score=30
RB2083_1376 transcriptional repressor NrdR [K] COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains RB2083:3.634..3.634 Mbp (321 bp) score=30
putR proline dehydrogenase transcriptional activator [K] COG1522 Transcriptional regulators RB2083:3.719..3.719 Mbp (474 bp) score=30
betI transcriptional repressor BetI [K] COG1309 Transcriptional regulator RB2083:3.961..3.961 Mbp (594 bp) score=30
RB2083_25 [K] COG1475 Predicted transcriptional regulators RB2083:20.33..21.26 kbp (933 bp) score=20
chvI DNA-binding response regulator ChvI [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:112.1..112.8 kbp (777 bp) score=20
RB2083_3814 transcriptional regulator, AraC family RB2083:157.5..158.5 kbp (1.008 kbp) score=20
RB2083_3342 transcriptional regulator, LacI family RB2083:183.7..184.6 kbp (921 bp) score=20
RB2083_3198 transcriptional regulator, AraC family RB2083:267.6..268.7 kbp (1.056 kbp) score=20
RB2083_1957 DNA-binding response regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RB2083:294.5..295.1 kbp (651 bp) score=20
RB2083_2035 [K] COG5662 Predicted transmembrane transcriptional regulator (anti-sigma factor) RB2083:324.3..324.7 kbp (363 bp) score=20
RB2083_1811 transcriptional regulator, LysR family, putative RB2083:370.8..370.9 kbp (117 bp) score=20
RB2083_2316 sensor histidine kinase/response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:400.9..401.3 kbp (348 bp) score=20
RB2083_2982 [K] COG1959 Predicted transcriptional regulator RB2083:476.6..476.8 kbp (210 bp) score=20
acpS [K] COG0583 Transcriptional regulator RB2083:489..489.4 kbp (408 bp) score=20
RB2083_2734 response regulator [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RB2083:513.3..513.7 kbp (363 bp) score=20
RB2083_1080 transcriptional regulator, LysR family RB2083:524.5..525.3 kbp (840 bp) score=20
luxR_1 autoinducer-binding transcriptional regulator LuxR RB2083:565.1..565.6 kbp (498 bp) score=20
RB2083_3911 GcrA cell cycle regulator [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:658.3..658.9 kbp (576 bp) score=20
pdhR [K] COG1802 Transcriptional regulators RB2083:693..693.8 kbp (777 bp) score=20
RB2083_67 transcriptional regulator, AraC family RB2083:740.3..741.1 kbp (819 bp) score=20
tauR transcriptional regulator RB2083:756.2..757.7 kbp (1.47 kbp) score=20
RB2083_2062 transcriptional regulator, AraC family RB2083:820.9..821.7 kbp (858 bp) score=20
RB2083_4070 [K] COG2378 Predicted transcriptional regulator; helix-turn-helix, type 11 RB2083:893..893.8 kbp (765 bp) score=20
RB2083_2364 nitrogen regulatory protein P-II [E] COG0347 Nitrogen regulatory protein PII RB2083:914..914.3 kbp (312 bp) score=20
RB2083_4065 [K] COG1414 Transcriptional regulator RB2083:927..927.8 kbp (780 bp) score=20
RB2083_1096 DNA-binding response regulator, LuxR family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:984.7..985.3 kbp (606 bp) score=20
ppsR transcriptional regulator PpsR RB2083:986.5..988 kbp (1.413 kbp) score=20
hrcA [K] COG1420 Transcriptional regulator of heat shock gene RB2083:1.266..1.268 Mbp (1.074 kbp) score=20
parB [K] COG1475 Predicted transcriptional regulators RB2083:1.27..1.271 Mbp (897 bp) score=20
regA photosynthetic apparatus regulatory protein RegA [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain RB2083:1.301..1.302 Mbp (555 bp) score=20
RB2083_101 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:1.498..1.499 Mbp (687 bp) score=20
RB2083_1741 [K] COG1396 Predicted transcriptional regulators RB2083:1.517..1.517 Mbp (573 bp) score=20
RB2083_418 transcriptional regulator, AraC family RB2083:1.55..1.551 Mbp (993 bp) score=20
RB2083_2308 nitrogen regulatory protein P-II [E] COG0347 Nitrogen regulatory protein PII RB2083:1.558..1.559 Mbp (339 bp) score=20
RB2083_1284 probable transcriptional regulator protein, AraC family, putative RB2083:1.614..1.614 Mbp (711 bp) score=20
RB2083_748 [K] COG1678 Putative transcriptional regulator RB2083:1.917..1.918 Mbp (576 bp) score=20
RB2083_3472 [K] COG1396 Predicted transcriptional regulators RB2083:1.974..1.975 Mbp (660 bp) score=20
RB2083_380 transcriptional regulator, AraC family RB2083:1.992..1.993 Mbp (1.011 kbp) score=20
glpR [KG] COG1349 Transcriptional regulators of sugar metabolism RB2083:2.002..2.003 Mbp (780 bp) score=20
xylR [KG] COG1940 Transcriptional regulator/sugar kinase RB2083:2.157..2.157 Mbp (426 bp) score=20
RB2083_1527 [KG] COG1940 Transcriptional regulator/sugar kinase RB2083:2.157..2.158 Mbp (795 bp) score=20
RB2083_2884 transcriptional regulator, AraC family RB2083:2.178..2.179 Mbp (984 bp) score=20
RB2083_2676 [K] COG1846 Transcriptional regulators RB2083:2.21..2.21 Mbp (198 bp) score=20
tctD two-component system regulatory protein [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:2.356..2.356 Mbp (669 bp) score=20
RB2083_1565 transcriptional regulator RB2083:2.454..2.454 Mbp (384 bp) score=20
RB2083_2873 [K] COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RB2083:2.713..2.714 Mbp (774 bp) score=20
RB2083_3469 transcriptional regulator, MerR family RB2083:2.819..2.82 Mbp (1.056 kbp) score=20
RB2083_3689 [K] COG1733 Predicted transcriptional regulators RB2083:2.827..2.828 Mbp (372 bp) score=20
RB2083_3565 transcriptional regulator, Crp/Fnr family RB2083:3.134..3.134 Mbp (189 bp) score=20
RB2083_1257 transcriptional regulator, Crp/Fnr family RB2083:3.134..3.134 Mbp (246 bp) score=20
scpB [K] COG1386 Predicted transcriptional regulator containing the HTH domain RB2083:3.158..3.159 Mbp (654 bp) score=20
luxR_2 autoinducer-binding transcriptional regulator LuxR RB2083:3.275..3.276 Mbp (735 bp) score=20
ctrA DNA-binding response regulator CtrA [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RB2083:3.296..3.297 Mbp (717 bp) score=20
RB2083_1815 transcriptional regulator, AraC family RB2083:3.349..3.35 Mbp (1.005 kbp) score=20
RB2083_1835 [K] COG0583 Transcriptional regulator RB2083:3.351..3.352 Mbp (822 bp) score=20
ntrC [KT] COG3829 Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains RB2083:3.379..3.38 Mbp (1.368 kbp) score=20
RB2083_2932 [K] COG1476 Predicted transcriptional regulators; Helix-turn-helix, putative RB2083:3.525..3.525 Mbp (207 bp) score=20
RB2083_3710 DNA-binding response regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RB2083:3.583..3.584 Mbp (606 bp) score=20
RB2083_3788 [K] COG1396 Predicted transcriptional regulators RB2083:3.611..3.612 Mbp (1.365 kbp) score=20
lexA [K] COG2932 Predicted transcriptional regulator RB2083:3.843..3.844 Mbp (699 bp) score=20
mgtE [K] COG0583 Transcriptional regulator RB2083:3.971..3.972 Mbp (1.392 kbp) score=20
repBf [K] COG1475 Predicted transcriptional regulators RB2083:4.016..4.017 Mbp (978 bp) score=20
RB2083_29 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:35.46..36.3 kbp (846 bp) score=10
RB2083_40 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:38.51..39.47 kbp (966 bp) score=10
RB2083_1447 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:102.8..103 kbp (201 bp) score=10
RB2083_2886 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:179.6..179.8 kbp (165 bp) score=10
soxA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:234..234.8 kbp (831 bp) score=10
soxZ [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:234.8..235.2 kbp (330 bp) score=10
RB2083_2164 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:277.6..278.2 kbp (603 bp) score=10
RB2083_2980 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:327.2..327.5 kbp (351 bp) score=10
RB2083_2226 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:342.1..343.4 kbp (1.353 kbp) score=10
RB2083_2406 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:354.4..354.5 kbp (165 bp) score=10
RB2083_1760 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:358.2..359.9 kbp (1.707 kbp) score=10
RB2083_1540 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:397.4..398.4 kbp (1.074 kbp) score=10
flaA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:404.3..406.9 kbp (2.649 kbp) score=10
RB2083_1169 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:419.3..419.8 kbp (543 bp) score=10
torF [KT] COG4650 Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain RB2083:445.1..446.2 kbp (1.167 kbp) score=10
RB2083_2250 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:452.5..456.8 kbp (4.296 kbp) score=10
RB2083_2804 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:479.6..480.6 kbp (1.02 kbp) score=10
RB2083_151 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:482.3..482.6 kbp (309 bp) score=10
RB2083_1110 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:552..552.4 kbp (384 bp) score=10
RB2083_511 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:562..562.7 kbp (759 bp) score=10
RB2083_743 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:567.6..568.9 kbp (1.356 kbp) score=10
RB2083_2529 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:577.7..578.4 kbp (714 bp) score=10
RB2083_1661 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:606.2..607.3 kbp (1.065 kbp) score=10
ectC [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:608.4..608.6 kbp (222 bp) score=10
RB2083_3849 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:611.9..612.4 kbp (447 bp) score=10
RB2083_2801 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:627.5..628.5 kbp (1.041 kbp) score=10
RB2083_1547 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:666.2..666.5 kbp (219 bp) score=10
RB2083_3293 [KT] COG3279 Response regulator of the LytR/AlgR family RB2083:670.4..671.2 kbp (798 bp) score=10
RB2083_107 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:683.1..683.3 kbp (171 bp) score=10
RB2083_630 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:692.2..692.6 kbp (348 bp) score=10
RB2083_4104 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:692.6..692.9 kbp (345 bp) score=10
RB2083_473 [K] COG5665 CCR4-NOT transcriptional regulation RB2083:720.3..721 kbp (651 bp) score=10
RB2083_1290 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:766.3..767 kbp (621 bp) score=10
RB2083_531 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:767.3..768.6 kbp (1.371 kbp) score=10
RB2083_3316 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:771.2..772.4 kbp (1.134 kbp) score=10
RB2083_393 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:789.7..790.2 kbp (501 bp) score=10
RB2083_3966 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:820.1..820.8 kbp (669 bp) score=10
RB2083_2397 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:825.4..827 kbp (1.578 kbp) score=10
RB2083_3215 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:827..827.2 kbp (195 bp) score=10
RB2083_2044 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:829..830.3 kbp (1.323 kbp) score=10
RB2083_3650 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:836.1..838.8 kbp (2.736 kbp) score=10
RB2083_3476 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:838.8..840.9 kbp (2.043 kbp) score=10
petR DNA-binding response regulator PetR RB2083:855.2..855.9 kbp (702 bp) score=10
RB2083_1968 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:889.6..889.9 kbp (312 bp) score=10
RB2083_3821 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:890.2..890.5 kbp (342 bp) score=10
RB2083_2391 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:893.8..894.5 kbp (729 bp) score=10
RB2083_2847 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:901.5..903.1 kbp (1.575 kbp) score=10
RB2083_3201 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:909.2..909.4 kbp (261 bp) score=10
RB2083_2424 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:920.8..921.6 kbp (777 bp) score=10
RB2083_2389 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:921.7..921.9 kbp (252 bp) score=10
RB2083_3871 response regulator receiver domain protein RB2083:931.8..932.5 kbp (711 bp) score=10
acsF [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.001..1.002 Mbp (1.131 kbp) score=10
RB2083_1482 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.01..1.011 Mbp (564 bp) score=10
pufM [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.013..1.014 Mbp (927 bp) score=10
pufL [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.014..1.015 Mbp (831 bp) score=10
RB2083_2038 response regulator receiver domain protein RB2083:1.072..1.073 Mbp (480 bp) score=10
RB2083_1171 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.088..1.089 Mbp (1.284 kbp) score=10
ykoS [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; alternate gene name: YkoR RB2083:1.126..1.128 Mbp (1.695 kbp) score=10
RB2083_3937 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.131..1.132 Mbp (702 bp) score=10
RB2083_2356 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.162..1.163 Mbp (1.077 kbp) score=10
ptsN nitrogen regulatory IIA protein RB2083:1.203..1.204 Mbp (465 bp) score=10
RB2083_3069 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.206..1.208 Mbp (1.68 kbp) score=10
RB2083_1120 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.208..1.209 Mbp (1.011 kbp) score=10
infB [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.23..1.232 Mbp (2.487 kbp) score=10
RB2083_2981 response regulator RB2083:1.253..1.255 Mbp (1.287 kbp) score=10
RB2083_2241 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.304..1.305 Mbp (465 bp) score=10
RB2083_2075 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.308..1.309 Mbp (1.056 kbp) score=10
RB2083_62 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.31..1.31 Mbp (342 bp) score=10
RB2083_3848 sensory box sensor histidine kinase/response regulator RB2083:1.325..1.325 Mbp (180 bp) score=10
RB2083_2625 sensory box sensor histidine kinase/response regulator RB2083:1.325..1.326 Mbp (378 bp) score=10
RB2083_3768 sensory box sensor histidine kinase/response regulator RB2083:1.326..1.326 Mbp (252 bp) score=10
RB2083_2457 sensory box sensor histidine kinase/response regulator RB2083:1.326..1.327 Mbp (378 bp) score=10
RB2083_2276 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.333..1.333 Mbp (537 bp) score=10
RB2083_1250 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.378..1.378 Mbp (324 bp) score=10
RB2083_2833 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.415..1.415 Mbp (771 bp) score=10
RB2083_2210 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.431..1.432 Mbp (663 bp) score=10
RB2083_1695 sensory box histidine kinase/response regulator RB2083:1.439..1.441 Mbp (1.92 kbp) score=10
RB2083_3923 response regulator RB2083:1.475..1.476 Mbp (720 bp) score=10
RB2083_1917 [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RB2083:1.516..1.516 Mbp (348 bp) score=10
RB2083_2251 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.525..1.526 Mbp (411 bp) score=10
RB2083_1703 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.535..1.535 Mbp (951 bp) score=10
RB2083_3954 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RB2083:1.552..1.554 Mbp (1.932 kbp) score=10
RB2083_2010 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.568..1.569 Mbp (564 bp) score=10
RB2083_1324 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.603..1.604 Mbp (615 bp) score=10
RB2083_1549 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.632..1.632 Mbp (177 bp) score=10
RB2083_3862 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.697..1.697 Mbp (243 bp) score=10
RB2083_589 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.751..1.752 Mbp (462 bp) score=10
RB2083_2791 ATP phosphoribosyltransferase regulatory subunit RB2083:1.764..1.765 Mbp (1.065 kbp) score=10
RB2083_3309 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RB2083:1.77..1.77 Mbp (231 bp) score=10
RB2083_3727 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.775..1.776 Mbp (684 bp) score=10
RB2083_3302 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.783..1.784 Mbp (321 bp) score=10
RB2083_2717 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.802..1.802 Mbp (711 bp) score=10
RB2083_2921 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.817..1.818 Mbp (1.35 kbp) score=10
RB2083_902 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.834..1.835 Mbp (1.215 kbp) score=10
RB2083_2959 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.882..1.883 Mbp (468 bp) score=10
RB2083_364 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.883..1.883 Mbp (174 bp) score=10
RB2083_3333 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.886..1.887 Mbp (543 bp) score=10
RB2083_2850 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.919..1.919 Mbp (201 bp) score=10
RB2083_3877 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.943..1.943 Mbp (645 bp) score=10
RB2083_2692 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.975..1.976 Mbp (1.068 kbp) score=10
RB2083_736 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:1.977..1.977 Mbp (114 bp) score=10
RB2083_3762 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.014..2.014 Mbp (306 bp) score=10
RB2083_3609 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.032..2.034 Mbp (2.16 kbp) score=10
RB2083_1058 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.081..2.082 Mbp (585 bp) score=10
RB2083_1787 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.095..2.096 Mbp (885 bp) score=10
RB2083_3579 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.099..2.1 Mbp (852 bp) score=10
RB2083_2106 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.174..2.174 Mbp (165 bp) score=10
RB2083_2675 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; contains weak similarity to succinyl-CoA synthetase alpha subunit RB2083:2.207..2.208 Mbp (1.482 kbp) score=10
RB2083_3360 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.209..2.21 Mbp (585 bp) score=10
RB2083_2183 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.21..2.21 Mbp (585 bp) score=10
RB2083_693 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.219..2.22 Mbp (585 bp) score=10
RB2083_2512 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.222..2.222 Mbp (285 bp) score=10
RB2083_1623 [KT] COG3279 Response regulator of the LytR/AlgR family RB2083:2.228..2.229 Mbp (870 bp) score=10
RB2083_4100 response regulator receiver protein RB2083:2.239..2.24 Mbp (1.248 kbp) score=10
RB2083_4058 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.241..2.242 Mbp (1.425 kbp) score=10
RB2083_756 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RB2083:2.246..2.247 Mbp (849 bp) score=10
RB2083_2793 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.269..2.27 Mbp (789 bp) score=10
RB2083_3210 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.295..2.295 Mbp (756 bp) score=10
RB2083_2558 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.301..2.302 Mbp (609 bp) score=10
RB2083_1156 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.319..2.321 Mbp (2.583 kbp) score=10
RB2083_3889 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.354..2.355 Mbp (483 bp) score=10
phaP [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.375..2.375 Mbp (444 bp) score=10
RB2083_951 [O] COG1764 Predicted redox protein, regulator of disulfide bond formation RB2083:2.389..2.389 Mbp (483 bp) score=10
ftsY [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.409..2.41 Mbp (1.2 kbp) score=10
RB2083_431 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.451..2.452 Mbp (954 bp) score=10
RB2083_3502 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RB2083:2.464..2.464 Mbp (684 bp) score=10
RB2083_2312 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.469..2.47 Mbp (1.248 kbp) score=10
RB2083_3929 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.493..2.494 Mbp (1.134 kbp) score=10
RB2083_1750 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.515..2.516 Mbp (1.002 kbp) score=10
RB2083_3252 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.543..2.543 Mbp (384 bp) score=10
RB2083_1127 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.591..2.592 Mbp (1.05 kbp) score=10
RB2083_1404 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.601..2.602 Mbp (1.413 kbp) score=10
RB2083_964 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.634..2.634 Mbp (423 bp) score=10
RB2083_4082 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.636..2.636 Mbp (420 bp) score=10
RB2083_2405 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.644..2.645 Mbp (312 bp) score=10
RB2083_3658 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.654..2.655 Mbp (1.02 kbp) score=10
RB2083_576 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.684..2.685 Mbp (801 bp) score=10
RB2083_3726 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.722..2.723 Mbp (1.02 kbp) score=10
RB2083_3789 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.754..2.755 Mbp (516 bp) score=10
RB2083_201 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.773..2.774 Mbp (1.041 kbp) score=10
RB2083_2272 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.804..2.805 Mbp (498 bp) score=10
RB2083_1258 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.806..2.807 Mbp (288 bp) score=10
RB2083_50 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.823..2.824 Mbp (579 bp) score=10
RB2083_2256 nitrile hydratase regulator1 RB2083:2.872..2.873 Mbp (1.128 kbp) score=10
RB2083_2937 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.954..2.956 Mbp (1.521 kbp) score=10
RB2083_1002 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:2.998..2.998 Mbp (696 bp) score=10
RB2083_3357 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.01..3.01 Mbp (411 bp) score=10
RB2083_3712 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; stress responsive alpha-beta barrel RB2083:3.044..3.044 Mbp (213 bp) score=10
nthA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.072..3.073 Mbp (642 bp) score=10
RB2083_2687 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.073..3.073 Mbp (318 bp) score=10
nthB [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.073..3.073 Mbp (309 bp) score=10
RB2083_2143 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.08..3.081 Mbp (786 bp) score=10
RB2083_3983 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.093..3.095 Mbp (1.119 kbp) score=10
RB2083_1840 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.095..3.095 Mbp (633 bp) score=10
RB2083_1758 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.112..3.112 Mbp (699 bp) score=10
RB2083_1890 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.155..3.156 Mbp (1.104 kbp) score=10
RB2083_654 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.181..3.181 Mbp (702 bp) score=10
RB2083_1340 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.195..3.196 Mbp (351 bp) score=10
RB2083_1545 regulatory protein GntR, HTH RB2083:3.196..3.197 Mbp (729 bp) score=10
RB2083_3692 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.23..3.231 Mbp (978 bp) score=10
RB2083_596 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RB2083:3.262..3.263 Mbp (852 bp) score=10
RB2083_313 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.265..3.265 Mbp (267 bp) score=10
RB2083_3582 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.267..3.268 Mbp (369 bp) score=10
RB2083_954 nitrogen regulatory protein P-II RB2083:3.272..3.272 Mbp (339 bp) score=10
RB2083_4088 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.287..3.288 Mbp (1.044 kbp) score=10
RB2083_923 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.296..3.296 Mbp (279 bp) score=10
RB2083_1016 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.328..3.33 Mbp (1.134 kbp) score=10
phoU phosphate transport system regulatory protein PhoU RB2083:3.338..3.339 Mbp (717 bp) score=10
RB2083_2294 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.366..3.366 Mbp (207 bp) score=10
ntrX [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RB2083:3.375..3.376 Mbp (1.413 kbp) score=10
RB2083_2212 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.386..3.386 Mbp (270 bp) score=10
RB2083_2021 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.386..3.387 Mbp (735 bp) score=10
RB2083_3542 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.395..3.395 Mbp (405 bp) score=10
RB2083_4013 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.413..3.414 Mbp (1.236 kbp) score=10
RB2083_3613 [O] COG0425 Predicted redox protein, regulator of disulfide bond formation RB2083:3.415..3.415 Mbp (234 bp) score=10
RB2083_1420 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.415..3.418 Mbp (2.73 kbp) score=10
RB2083_2003 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.434..3.434 Mbp (576 bp) score=10
RB2083_3144 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.445..3.446 Mbp (882 bp) score=10
RB2083_605 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.491..3.492 Mbp (525 bp) score=10
RB2083_3207 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.503..3.503 Mbp (561 bp) score=10
RB2083_2328 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.508..3.511 Mbp (3.309 kbp) score=10
cckA sensor histidine kinase/response regulator RB2083:3.541..3.543 Mbp (2.208 kbp) score=10
RB2083_3900 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.563..3.563 Mbp (561 bp) score=10
RB2083_580 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.574..3.575 Mbp (417 bp) score=10
ilvN [E] COG0440 Acetolactate synthase, small (regulatory) subunit RB2083:3.587..3.588 Mbp (561 bp) score=10
RB2083_1581 response regulator receiver domain protein RB2083:3.61..3.611 Mbp (369 bp) score=10
RB2083_722 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.635..3.635 Mbp (531 bp) score=10
RB2083_565 transcriptional activator HlyU RB2083:3.635..3.635 Mbp (144 bp) score=10
RB2083_3236 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.721..3.721 Mbp (207 bp) score=10
RB2083_2039 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.75..3.751 Mbp (1.068 kbp) score=10
RB2083_3619 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.776..3.778 Mbp (1.653 kbp) score=10
RB2083_255 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.786..3.787 Mbp (1.107 kbp) score=10
RB2083_1206 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.837..3.839 Mbp (1.392 kbp) score=10
RB2083_1031 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.858..3.859 Mbp (1.284 kbp) score=10
RB2083_1189 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.884..3.885 Mbp (585 bp) score=10
RB2083_584 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.897..3.898 Mbp (198 bp) score=10
RB2083_1786 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.912..3.913 Mbp (732 bp) score=10
RB2083_3801 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.949..3.949 Mbp (207 bp) score=10
RB2083_2721 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:3.949..3.95 Mbp (360 bp) score=10
RB2083_1322 [V] COG3023 Negative regulator of beta-lactamase expression RB2083:3.985..3.986 Mbp (615 bp) score=10
RB2083_4211 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:4.005..4.005 Mbp (459 bp) score=10
RB2083_4214 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:4.013..4.013 Mbp (669 bp) score=10
RB2083_4204 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RB2083:4.015..4.016 Mbp (1.053 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70