Roseobase: Roseobacter sp. R2A57

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: R2A57:300000..400000, R2A57_4357, atpA, transcriptional regulator, LMSEQDVRYFTGFHTLFWQSPTRPWFVFVPTVGKPVAVIPEIGAELMRRSWLDDIRTW.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 222 regions match your request.
Matches on R2A57
overview_R2A57
R2A57_0046 putative TetR family transcriptional regulator R2A57:42.24..42.43 kbp (189 bp) score=20
dctD_1 C4-dicarboxylate transport transcriptional regulatory protein DctD R2A57:61.37..62.7 kbp (1.335 kbp) score=20
R2A57_0084 transcriptional regulator R2A57:71.53..72.15 kbp (624 bp) score=20
R2A57_0090 LuxR family transcriptional regulator R2A57:76.81..77.1 kbp (285 bp) score=20
R2A57_0141 TetR family transcriptional regulator R2A57:125.1..125.7 kbp (618 bp) score=20
R2A57_0155 cell cycle transcriptional regulator CtrA R2A57:137.7..138.4 kbp (720 bp) score=20
R2A57_0175 AraC family transcriptional regulator R2A57:154.6..155.5 kbp (933 bp) score=20
R2A57_0203 AraC family transcriptional regulator R2A57:183..184 kbp (993 bp) score=20
R2A57_0204 LysR family transcriptional regulator R2A57:184.5..185.4 kbp (870 bp) score=20
R2A57_0221 MerR family transcriptional regulator R2A57:198.3..199.2 kbp (912 bp) score=20
R2A57_0224 AsnC family transcriptional regulator R2A57:200.5..201 kbp (537 bp) score=20
R2A57_0249 LysR family transcriptional regulator R2A57:222..223 kbp (1.029 kbp) score=20
R2A57_0271 XRE family transcriptional regulator R2A57:243.3..244.2 kbp (816 bp) score=20
dctD_2 C4-dicarboxylate transport transcriptional regulatory protein DctD R2A57:279.5..280.7 kbp (1.227 kbp) score=20
R2A57_0456 TetR family transcriptional regulator R2A57:415.2..415.9 kbp (672 bp) score=20
R2A57_0469 putative transcriptional regulator R2A57:425.1..425.4 kbp (303 bp) score=20
R2A57_0476 AsnC family transcriptional regulator R2A57:432.8..433.3 kbp (456 bp) score=20
R2A57_0480 CarD family transcriptional regulator R2A57:437.1..437.6 kbp (519 bp) score=20
R2A57_0490 TraR/DksA family transcriptional regulator R2A57:446.7..447 kbp (270 bp) score=20
R2A57_0506 AbrB family transcriptional regulator R2A57:458.5..458.6 kbp (141 bp) score=20
R2A57_0532 putative transcriptional regulator, LysR family R2A57:484.6..485.5 kbp (909 bp) score=20
R2A57_0578 LuxR family transcriptional regulator R2A57:529..529.6 kbp (543 bp) score=20
R2A57_0635 XRE family transcriptional regulator R2A57:579.9..581.3 kbp (1.401 kbp) score=20
R2A57_0661 MerR family transcriptional regulator R2A57:605.4..605.8 kbp (372 bp) score=20
R2A57_0662 MerR family transcriptional regulator R2A57:605.9..606.3 kbp (429 bp) score=20
R2A57_0698 AraC family transcriptional regulator R2A57:640.2..641.3 kbp (1.074 kbp) score=20
R2A57_0710 putative transcriptional regulator R2A57:649.9..650.9 kbp (990 bp) score=20
R2A57_0747 TetR family transcriptional regulator R2A57:676.6..677.1 kbp (531 bp) score=20
R2A57_0752 LysR family transcriptional regulator R2A57:680.2..681.1 kbp (906 bp) score=20
R2A57_0773 TetR family transcriptional regulator R2A57:699.6..700.3 kbp (693 bp) score=20
R2A57_0779 GntR family transcriptional regulator R2A57:704.3..705.7 kbp (1.458 kbp) score=20
R2A57_0792 Bkd operon transcriptional regulator R2A57:719..719.5 kbp (516 bp) score=20
R2A57_0801 LysR family transcriptional regulator R2A57:727..727.9 kbp (897 bp) score=20
R2A57_0815 LysR family transcriptional regulator R2A57:741.5..742.4 kbp (906 bp) score=20
R2A57_0832 GntR family transcriptional regulator R2A57:754.5..755.1 kbp (651 bp) score=20
R2A57_0846 LysR family transcriptional regulator R2A57:767..767.9 kbp (873 bp) score=20
R2A57_0869 Crp/FNR family transcriptional regulator R2A57:791..791.7 kbp (708 bp) score=20
R2A57_0887 HTH-type transcriptional regulator PetP R2A57:807.8..808.3 kbp (498 bp) score=20
R2A57_0899 AraC family transcriptional regulator R2A57:818.8..819.7 kbp (957 bp) score=20
R2A57_0945 putative transcriptional regulator R2A57:863.5..864 kbp (591 bp) score=20
R2A57_0981 LysR family transcriptional regulator R2A57:899.1..899.2 kbp (159 bp) score=20
R2A57_0991 LuxR family transcriptional regulator R2A57:908.1..908.8 kbp (723 bp) score=20
R2A57_1009 negative transcriptional regulator R2A57:921.4..922 kbp (633 bp) score=20
R2A57_1019 transcriptional regulator R2A57:930..931 kbp (996 bp) score=20
R2A57_1068 GntR family transcriptional regulator R2A57:983.7..984.4 kbp (693 bp) score=20
R2A57_1167 MarR family transcriptional regulator R2A57:1.076..1.077 Mbp (438 bp) score=20
R2A57_1269 two component transcriptional regulator R2A57:1.179..1.179 Mbp (687 bp) score=20
R2A57_1293 LysR family transcriptional regulator R2A57:1.205..1.206 Mbp (936 bp) score=20
R2A57_1320 MarR family transcriptional regulator R2A57:1.227..1.227 Mbp (468 bp) score=20
R2A57_1365 AsnC family transcriptional regulator R2A57:1.271..1.272 Mbp (456 bp) score=20
R2A57_1366 AsnC family transcriptional regulator R2A57:1.272..1.272 Mbp (456 bp) score=20
R2A57_1373 GntR family transcriptional regulator R2A57:1.276..1.277 Mbp (639 bp) score=20
R2A57_1379 putative AraC family transcriptional regulator R2A57:1.284..1.285 Mbp (1.02 kbp) score=20
R2A57_1407 MarR family transcriptional regulator R2A57:1.317..1.317 Mbp (423 bp) score=20
R2A57_1457 HTH-type transcriptional regulator RutR R2A57:1.365..1.365 Mbp (624 bp) score=20
R2A57_1458 HTH-type transcriptional regulator RutR R2A57:1.365..1.366 Mbp (636 bp) score=20
cueR Cu(I)-responsive transcriptional regulator R2A57:1.396..1.396 Mbp (387 bp) score=20
R2A57_1493 AraC family transcriptional regulator R2A57:1.4..1.401 Mbp (999 bp) score=20
R2A57_1518 AraC family transcriptional regulator R2A57:1.43..1.431 Mbp (975 bp) score=20
R2A57_1519 AraC family transcriptional regulator R2A57:1.431..1.432 Mbp (390 bp) score=20
R2A57_1520 AraC family transcriptional regulator R2A57:1.432..1.432 Mbp (558 bp) score=20
R2A57_1578 transcriptional regulatory protein R2A57:1.479..1.48 Mbp (810 bp) score=20
R2A57_1585 TetR family transcriptional regulator R2A57:1.488..1.488 Mbp (630 bp) score=20
R2A57_1595 AraC family transcriptional regulator R2A57:1.496..1.497 Mbp (894 bp) score=20
R2A57_1665 LysR family transcriptional regulator R2A57:1.564..1.565 Mbp (966 bp) score=20
R2A57_1728 LysR family transcriptional regulator R2A57:1.619..1.62 Mbp (870 bp) score=20
R2A57_1746 WhiB family transcriptional regulator R2A57:1.634..1.634 Mbp (141 bp) score=20
R2A57_1747 FUR family transcriptional regulator R2A57:1.634..1.634 Mbp (417 bp) score=20
R2A57_1850 transcriptional regulatory protein R2A57:1.724..1.724 Mbp (369 bp) score=20
phnF phosphonate metabolism transcriptional regulator PhnF R2A57:1.815..1.815 Mbp (732 bp) score=20
R2A57_1952 AraC family transcriptional regulator R2A57:1.818..1.819 Mbp (1.002 kbp) score=20
R2A57_2019 LysR family transcriptional regulator R2A57:1.875..1.876 Mbp (885 bp) score=20
R2A57_2031 TetR family transcriptional regulator R2A57:1.884..1.885 Mbp (588 bp) score=20
R2A57_2043 MarR family transcriptional regulator R2A57:1.894..1.895 Mbp (438 bp) score=20
R2A57_2062 MarR family transcriptional regulator R2A57:1.91..1.911 Mbp (558 bp) score=20
R2A57_2064 TetR family transcriptional regulator R2A57:1.911..1.912 Mbp (597 bp) score=20
R2A57_2181 TetR family transcriptional regulator R2A57:2.012..2.013 Mbp (552 bp) score=20
R2A57_2252 LysR family transcriptional regulator R2A57:2.076..2.077 Mbp (894 bp) score=20
R2A57_2264 GntR family transcriptional regulator R2A57:2.093..2.094 Mbp (774 bp) score=20
R2A57_2315 transcriptional regulator R2A57:2.138..2.139 Mbp (216 bp) score=20
R2A57_2403 autoinducer-binding transcriptional regulator LuxR R2A57:2.215..2.216 Mbp (654 bp) score=20
R2A57_2448 ArsR family transcriptional regulator R2A57:2.26..2.26 Mbp (315 bp) score=20
R2A57_2486 putative HTH-type transcriptional regulator EutR R2A57:2.295..2.296 Mbp (990 bp) score=20
R2A57_2491 LysR family transcriptional regulator R2A57:2.299..2.299 Mbp (900 bp) score=20
R2A57_2493 XRE family transcriptional regulator R2A57:2.301..2.301 Mbp (366 bp) score=20
R2A57_2547 TetR family transcriptional regulator R2A57:2.355..2.356 Mbp (672 bp) score=20
R2A57_2555 GntR family transcriptional regulator R2A57:2.363..2.364 Mbp (693 bp) score=20
R2A57_2578 transcriptional regulator R2A57:2.383..2.384 Mbp (663 bp) score=20
R2A57_2594 AraC family transcriptional regulator R2A57:2.4..2.401 Mbp (1.077 kbp) score=20
R2A57_2608 putative TetR family transcriptional regulator R2A57:2.412..2.412 Mbp (651 bp) score=20
R2A57_2672 IclR family transcriptional regulator R2A57:2.48..2.48 Mbp (837 bp) score=20
R2A57_2679 GntR family transcriptional regulator R2A57:2.486..2.487 Mbp (651 bp) score=20
R2A57_2703 TetR family transcriptional regulator R2A57:2.507..2.507 Mbp (588 bp) score=20
R2A57_2754 transcriptional regulator, LysR family R2A57:2.55..2.551 Mbp (885 bp) score=20
R2A57_2764 TetR family transcriptional regulator R2A57:2.56..2.561 Mbp (597 bp) score=20
R2A57_2880 AraC family transcriptional regulator R2A57:2.664..2.665 Mbp (1.005 kbp) score=20
R2A57_2920 LysR family transcriptional regulator R2A57:2.703..2.704 Mbp (957 bp) score=20
R2A57_2938 LysR family transcriptional regulator R2A57:2.719..2.72 Mbp (906 bp) score=20
R2A57_2974 putative HTH-type transcriptional regulator aq_268 R2A57:2.754..2.754 Mbp (138 bp) score=20
R2A57_2996 LysR family transcriptional regulator R2A57:2.774..2.775 Mbp (912 bp) score=20
R2A57_3001 AsnC family transcriptional regulator R2A57:2.779..2.779 Mbp (426 bp) score=20
R2A57_3074 AraC family transcriptional regulator R2A57:2.85..2.851 Mbp (963 bp) score=20
R2A57_3081 putative MarR family transcriptional regulator R2A57:2.857..2.857 Mbp (474 bp) score=20
R2A57_3082 transcriptional regulator, TetR family R2A57:2.857..2.858 Mbp (627 bp) score=20
R2A57_3088 LysR family transcriptional regulator R2A57:2.863..2.864 Mbp (918 bp) score=20
R2A57_3091 LysR family transcriptional regulator R2A57:2.866..2.867 Mbp (930 bp) score=20
R2A57_3120 transcriptional regulatory protein ChvI R2A57:2.893..2.894 Mbp (702 bp) score=20
R2A57_3132 TetR family transcriptional regulator R2A57:2.908..2.909 Mbp (684 bp) score=20
R2A57_3154 HxlR family transcriptional regulator R2A57:2.935..2.935 Mbp (366 bp) score=20
R2A57_3206 AraC family transcriptional regulator R2A57:2.98..2.981 Mbp (987 bp) score=20
R2A57_3255 HTH-type transcriptional regulator PuuR R2A57:3.028..3.029 Mbp (567 bp) score=20
R2A57_3266 LuxR family transcriptional regulator R2A57:3.038..3.039 Mbp (612 bp) score=20
R2A57_3336 LysR family transcriptional regulator R2A57:3.108..3.109 Mbp (996 bp) score=20
R2A57_3339 LysR family transcriptional regulator R2A57:3.111..3.112 Mbp (885 bp) score=20
R2A57_3358 putative AraC family transcriptional regulator R2A57:3.132..3.133 Mbp (1.002 kbp) score=20
R2A57_3385 XRE family transcriptional regulator R2A57:3.154..3.155 Mbp (858 bp) score=20
R2A57_3389 HTH-type transcriptional regulator GlxA R2A57:3.158..3.159 Mbp (981 bp) score=20
R2A57_3422 putative LysR family transcriptional regulator R2A57:3.184..3.185 Mbp (216 bp) score=20
R2A57_3432 molybdenum-binding transcriptional regulator R2A57:3.195..3.195 Mbp (372 bp) score=20
R2A57_3475 putative transcriptional regulator, TetR family R2A57:3.239..3.24 Mbp (615 bp) score=20
R2A57_3476 transcriptional regulator R2A57:3.24..3.24 Mbp (675 bp) score=20
R2A57_3485 LysR family transcriptional regulator R2A57:3.249..3.25 Mbp (975 bp) score=20
R2A57_3487 putative AraC family transcriptional regulator R2A57:3.252..3.253 Mbp (1.035 kbp) score=20
R2A57_3522 HTH-type transcriptional regulator IscR R2A57:3.284..3.285 Mbp (462 bp) score=20
R2A57_3556 HTH-type transcriptional regulator GlxA R2A57:3.317..3.318 Mbp (1.005 kbp) score=20
phoB phosphate regulon transcriptional regulatory protein PhoB R2A57:3.329..3.33 Mbp (690 bp) score=20
R2A57_3640 transcriptional regulator, LysR family R2A57:3.383..3.384 Mbp (915 bp) score=20
R2A57_3684 MarR family transcriptional regulator R2A57:3.421..3.421 Mbp (216 bp) score=20
R2A57_3685 MarR family transcriptional regulator R2A57:3.422..3.422 Mbp (228 bp) score=20
R2A57_3693 RpiR family transcriptional regulator R2A57:3.429..3.43 Mbp (915 bp) score=20
R2A57_3708 ArsR family transcriptional regulator R2A57:3.441..3.442 Mbp (759 bp) score=20
R2A57_3754 XRE family transcriptional regulator R2A57:3.48..3.481 Mbp (1.299 kbp) score=20
R2A57_3755 transcriptional regulatory protein WalR R2A57:3.481..3.481 Mbp (369 bp) score=20
R2A57_3786 LysR family transcriptional regulator R2A57:3.505..3.506 Mbp (879 bp) score=20
R2A57_3800 transcriptional regulator, sarp family R2A57:3.515..3.515 Mbp (207 bp) score=20
R2A57_3919 MarR-family transcriptional regulator R2A57:3.615..3.616 Mbp (486 bp) score=20
R2A57_3941 AraC family transcriptional regulator R2A57:3.625..3.626 Mbp (729 bp) score=20
R2A57_3943 transcriptional regulator R2A57:3.627..3.627 Mbp (240 bp) score=20
R2A57_4024 AsnC family transcriptional regulator R2A57:3.713..3.714 Mbp (420 bp) score=20
R2A57_4035 LuxR family transcriptional regulator R2A57:3.725..3.726 Mbp (543 bp) score=20
R2A57_4036 LysR family transcriptional regulator R2A57:3.726..3.727 Mbp (969 bp) score=20
R2A57_4053 transcriptional regulator, Fur family R2A57:3.744..3.744 Mbp (441 bp) score=20
R2A57_4084 TetR family transcriptional regulator R2A57:3.787..3.788 Mbp (645 bp) score=20
R2A57_4088 TetR family transcriptional regulator R2A57:3.792..3.793 Mbp (675 bp) score=20
R2A57_4111 phosphate regulon transcriptional regulatory protein PhoB R2A57:3.818..3.818 Mbp (393 bp) score=20
R2A57_4122 transcriptional regulatory protein R2A57:3.824..3.825 Mbp (1.089 kbp) score=20
R2A57_4128 AsnC family transcriptional regulator R2A57:3.829..3.829 Mbp (495 bp) score=20
R2A57_4127 putative Crp/FNR family transcriptional regulator R2A57:3.829..3.83 Mbp (714 bp) score=20
R2A57_4133 TetR family transcriptional regulator R2A57:3.833..3.833 Mbp (612 bp) score=20
R2A57_4142 LysR family transcriptional regulator R2A57:3.844..3.845 Mbp (882 bp) score=20
R2A57_4193 GntR family transcriptional regulator R2A57:3.891..3.891 Mbp (756 bp) score=20
R2A57_4232 AraC family transcriptional regulator R2A57:3.931..3.932 Mbp (945 bp) score=20
R2A57_4254 LysR family transcriptional regulator R2A57:3.956..3.957 Mbp (921 bp) score=20
R2A57_4286 GntR family transcriptional regulator R2A57:3.985..3.985 Mbp (153 bp) score=20
R2A57_4342 IclR family transcriptional regulator R2A57:4.047..4.047 Mbp (789 bp) score=20
R2A57_4363 HTH-type transcriptional regulator MetR R2A57:4.069..4.07 Mbp (912 bp) score=20
R2A57_4382 transcriptional regulatory protein R2A57:4.084..4.085 Mbp (366 bp) score=20
R2A57_4392 LysR family transcriptional regulator R2A57:4.091..4.092 Mbp (894 bp) score=20
R2A57_4402 transcriptional regulator, XRE family R2A57:4.099..4.099 Mbp (144 bp) score=20
R2A57_4429 LysR family transcriptional regulator R2A57:4.126..4.126 Mbp (933 bp) score=20
R2A57_0037 LuxR family DNA-binding response regulator R2A57:37.18..37.41 kbp (231 bp) score=10
R2A57_0107 nitrogen assimilation regulatory protein NtrX R2A57:93.46..94.88 kbp (1.419 kbp) score=10
R2A57_0265 oxygen regulatory protein NreC R2A57:238.2..238.8 kbp (645 bp) score=10
R2A57_0314 glutamate uptake regulatory protein R2A57:282.6..283 kbp (471 bp) score=10
R2A57_0495 putative regulator of conserved transcripts 3A R2A57:450.7..450.9 kbp (213 bp) score=10
R2A57_0597 regulatory protein SoxS R2A57:545.9..546.3 kbp (369 bp) score=10
betI_1 transcriptional repressor BetI R2A57:585.7..586.3 kbp (585 bp) score=10
betI_2 transcriptional repressor BetI R2A57:587.8..588.4 kbp (576 bp) score=10
R2A57_0718 leucine-responsive regulatory protein R2A57:657.2..657.6 kbp (444 bp) score=10
lrp_1 leucine-responsive regulatory protein R2A57:752.3..752.8 kbp (453 bp) score=10
R2A57_1028 sensor histidine kinase/response regulator R2A57:938.8..941 kbp (2.184 kbp) score=10
R2A57_1096 photosynthetic apparatus regulatory protein RegA R2A57:1.012..1.013 Mbp (555 bp) score=10
R2A57_1147 response regulator R2A57:1.062..1.063 Mbp (846 bp) score=10
R2A57_1149 response regulator R2A57:1.063..1.063 Mbp (480 bp) score=10
R2A57_1207 nitrogen regulatory protein R2A57:1.12..1.12 Mbp (465 bp) score=10
R2A57_1223 LacI family transcription regulator R2A57:1.131..1.132 Mbp (1.02 kbp) score=10
R2A57_1234 response regulator receiver protein R2A57:1.146..1.147 Mbp (705 bp) score=10
R2A57_1280 regulatory protein VirG R2A57:1.189..1.19 Mbp (705 bp) score=10
R2A57_1281 sensory box histidine kinase/response regulator R2A57:1.19..1.192 Mbp (1.908 kbp) score=10
R2A57_1387 putative response regulator receiver protein R2A57:1.291..1.292 Mbp (819 bp) score=10
R2A57_1408 regulatory protein R2A57:1.317..1.318 Mbp (1.122 kbp) score=10
R2A57_1441 response regulator receiver protein R2A57:1.35..1.351 Mbp (396 bp) score=10
lrp_2 leucine-responsive regulatory protein R2A57:1.404..1.404 Mbp (459 bp) score=10
R2A57_1534 ferric uptake regulator family protein R2A57:1.443..1.444 Mbp (387 bp) score=10
R2A57_1545 LacI family transcription regulator R2A57:1.452..1.453 Mbp (1.041 kbp) score=10
R2A57_1570 LacI family transcription regulator R2A57:1.473..1.474 Mbp (1.029 kbp) score=10
R2A57_1627 response regulator R2A57:1.531..1.532 Mbp (705 bp) score=10
R2A57_1646 GcrA cell cycle regulator R2A57:1.544..1.544 Mbp (564 bp) score=10
R2A57_1717 response regulator receiver protein R2A57:1.608..1.609 Mbp (693 bp) score=10
R2A57_1797 response regulator receiver protein R2A57:1.675..1.676 Mbp (1.272 kbp) score=10
lrp_3 leucine-responsive regulatory protein R2A57:1.704..1.705 Mbp (501 bp) score=10
R2A57_1889 ATP phosphoribosyltransferase regulatory subunit R2A57:1.76..1.761 Mbp (1.086 kbp) score=10
R2A57_1903 glycine cleavage system transcriptional activator R2A57:1.775..1.776 Mbp (852 bp) score=10
lrp_4 leucine-responsive regulatory protein R2A57:1.827..1.827 Mbp (450 bp) score=10
R2A57_1984 transcriptional activator protein FnrL R2A57:1.847..1.848 Mbp (747 bp) score=10
R2A57_2013 glycine cleavage system transcriptional activator R2A57:1.872..1.872 Mbp (924 bp) score=10
hpaR homoprotocatechuate degradation operon regulator, HpaR R2A57:1.924..1.924 Mbp (441 bp) score=10
R2A57_2101 nitrogen regulatory protein P-II R2A57:1.948..1.948 Mbp (339 bp) score=10
R2A57_2136 flagellar synthesis regulator R2A57:1.975..1.975 Mbp (189 bp) score=10
R2A57_2209 response regulator R2A57:2.032..2.033 Mbp (363 bp) score=10
R2A57_2281 LacI family transcription regulator R2A57:2.107..2.108 Mbp (1.02 kbp) score=10
R2A57_2344 glycine cleavage system transcriptional activator R2A57:2.165..2.166 Mbp (951 bp) score=10
R2A57_2612 RpiR family transcription regulator R2A57:2.416..2.417 Mbp (873 bp) score=10
R2A57_2643 sensory box histidine kinase/response regulator R2A57:2.445..2.447 Mbp (2.505 kbp) score=10
R2A57_2663 transcriptional activator ChrR R2A57:2.468..2.469 Mbp (636 bp) score=10
R2A57_2717 glutamate uptake regulatory protein R2A57:2.518..2.518 Mbp (468 bp) score=10
R2A57_2850 nitrogen regulatory protein P-II R2A57:2.639..2.639 Mbp (339 bp) score=10
soxR redox-sensitive transcriptional activator SoxR R2A57:2.763..2.764 Mbp (465 bp) score=10
R2A57_3068 response regulator receiver protein R2A57:2.846..2.847 Mbp (810 bp) score=10
R2A57_3188 zinc uptake transcriptional repressor R2A57:2.963..2.964 Mbp (402 bp) score=10
R2A57_3214 putative anti-sigma regulatory factor, serine/threonine protein kinase R2A57:2.988..2.988 Mbp (369 bp) score=10
R2A57_3236 ADA regulatory protein R2A57:3.007..3.007 Mbp (846 bp) score=10
R2A57_3270 proline dehydrogenase transcriptional activator R2A57:3.042..3.042 Mbp (480 bp) score=10
R2A57_3305 putative two component regulator R2A57:3.077..3.078 Mbp (975 bp) score=10
R2A57_3375 diguanylate cyclase response regulator R2A57:3.147..3.148 Mbp (1.446 kbp) score=10
R2A57_3439 regulatory protein NosR R2A57:3.202..3.204 Mbp (2.175 kbp) score=10
phoU phosphate transport system regulatory protein PhoU R2A57:3.328..3.329 Mbp (714 bp) score=10
R2A57_3570 ATP-dependent transcription regulator LuxR R2A57:3.33..3.331 Mbp (753 bp) score=10
R2A57_3861 putative response regulator receiver protein R2A57:3.565..3.566 Mbp (945 bp) score=10
R2A57_3899 transcriptional repressor NrdR R2A57:3.599..3.6 Mbp (468 bp) score=10
R2A57_4348 glycine cleavage system transcriptional activator R2A57:4.054..4.055 Mbp (897 bp) score=10
lrp_5 leucine-responsive regulatory protein R2A57:4.063..4.063 Mbp (483 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70