Roseobase: Pelagibaca bermudensis HTCC2601

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: R2601:300000..400000, R2601_00025, R2601_t26522, R2601_r15835, carB, ZP_01443784, transcriptional regulator, MRHSLPLAPQFYVTAPQPCPYLPGRMERKLFTALQGDSAEKL.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 367 regions match your request.
Matches on R2601
overview_R2601
R2601_21572 regulatory protein, LacI:Periplasmic binding protein/LacI transcriptional regulator COG1609 Transcriptional regulators R2601:4.297..4.298 Mbp (1.029 kbp) score=50
R2601_22497 probable transcriptional regulator transcription regulator protein COG0583 Transcriptional regulator R2601:4.498..4.499 Mbp (858 bp) score=50
R2601_00005 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:1..244 bp (244 bp) score=40
R2601_00100 hypothetical transcriptional regulator protein COG1309 Transcriptional regulator R2601:21.42..21.96 kbp (546 bp) score=40
R2601_00110 putative transcriptional regulator, lysR family protein COG0583 Transcriptional regulator R2601:22.74..23.68 kbp (933 bp) score=40
R2601_00125 putative GntR-family transcriptional regulator COG1802 Transcriptional regulators R2601:25.16..25.55 kbp (384 bp) score=40
R2601_00165 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators R2601:34.52..35.54 kbp (1.017 kbp) score=40
R2601_00260 LysR-family transcriptional regulator COG0583 Transcriptional regulator R2601:55.45..56.35 kbp (903 bp) score=40
R2601_00570 transcriptional regulatory protein COG0583 Transcriptional regulator R2601:109.1..110 kbp (927 bp) score=40
R2601_00840 Bacterial regulatory proteins, AsnC family:Bacterial regulatory protein, GntR family COG1802 Transcriptional regulators R2601:177.1..177.8 kbp (708 bp) score=40
R2601_00890 transcriptional regulatory protein COG0583 Transcriptional regulator R2601:188.5..189.4 kbp (990 bp) score=40
R2601_00995 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:211.6..212.2 kbp (699 bp) score=40
R2601_01035 transcriptional regulator (IclR family) protein COG1414 Transcriptional regulator R2601:221.3..222.1 kbp (789 bp) score=40
R2601_01150 probable transcriptional regulator protein, GntR family COG2186 Transcriptional regulators R2601:247.2..247.9 kbp (723 bp) score=40
R2601_01205 transcriptional regulator COG0583 Transcriptional regulator R2601:259..259.9 kbp (930 bp) score=40
R2601_01240 transcriptional regulatory protein COG1309 Transcriptional regulator R2601:267.2..267.9 kbp (696 bp) score=40
R2601_01290 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:275.7..276.5 kbp (723 bp) score=40
R2601_01305 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:278.5..279.4 kbp (912 bp) score=40
R2601_01518 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:326.9..327.4 kbp (507 bp) score=40
R2601_01583 Transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:340.4..341 kbp (612 bp) score=40
R2601_01593 hypothetical LysR, Transcriptional regulator COG0583 Transcriptional regulator R2601:341.7..342.6 kbp (888 bp) score=40
R2601_01598 possible transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:342.6..343.2 kbp (615 bp) score=40
R2601_01618 Transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:347.4..348.1 kbp (633 bp) score=40
R2601_01658 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:357.1..357.9 kbp (723 bp) score=40
R2601_01678 transcriptional regulator, AraC family protein COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain R2601:361.1..362.1 kbp (954 bp) score=40
R2601_01698 putative transcriptional regulator protein COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain R2601:364.2..365.1 kbp (951 bp) score=40
R2601_01743 transcriptional regulatory protein COG1802 Transcriptional regulators R2601:373.6..374.3 kbp (708 bp) score=40
R2601_01753 transcriptional regulator, GntR family protein COG2186 Transcriptional regulators R2601:375.4..376.1 kbp (732 bp) score=40
R2601_01928 putative transcriptional regulator protein, AsnC/GntR family COG1802 Transcriptional regulators R2601:412..412.7 kbp (726 bp) score=40
R2601_01963 Transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:418.4..419 kbp (621 bp) score=40
R2601_02023 AraC family transcriptional regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain R2601:432.1..433.1 kbp (1.023 kbp) score=40
R2601_02098 transcriptional regulator COG0583 Transcriptional regulator R2601:448.9..449.8 kbp (906 bp) score=40
R2601_02228 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:476.2..477.1 kbp (903 bp) score=40
R2601_02253 transcriptional regulatory protein COG0583 Transcriptional regulator R2601:480.8..481.7 kbp (894 bp) score=40
R2601_02268 putative transcriptional regulator, lysR family protein COG0583 Transcriptional regulator R2601:483.7..484.7 kbp (927 bp) score=40
R2601_02308 transcriptional regulator COG1522 Transcriptional regulators R2601:493.1..493.6 kbp (507 bp) score=40
R2601_02358 transcriptional regulator, GntR family protein COG2188 Transcriptional regulators R2601:505.6..506.4 kbp (783 bp) score=40
R2601_02463 putative GntR-family transcriptional regulator COG2188 Transcriptional regulators R2601:526.8..527.6 kbp (783 bp) score=40
R2601_02508 transcriptional regulator, GntR family protein COG2186 Transcriptional regulators R2601:536.4..537.1 kbp (711 bp) score=40
R2601_02588 transcriptional regulator COG0583 Transcriptional regulator R2601:552.3..553.4 kbp (1.005 kbp) score=40
R2601_02603 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:555.3..556.2 kbp (894 bp) score=40
R2601_02613 transcriptional regulator, ArsR familyy protein COG0640 Predicted transcriptional regulators R2601:556.4..556.8 kbp (339 bp) score=40
R2601_02648 putative transcriptional regulator protein COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain R2601:564.1..565 kbp (972 bp) score=40
R2601_03068 transcriptional regulator, GntR family protein COG2186 Transcriptional regulators R2601:638.2..638.6 kbp (444 bp) score=40
R2601_03593 transcriptional regulator COG1309 Transcriptional regulator R2601:679.1..679.9 kbp (762 bp) score=40
R2601_04278 transcriptional regulator, GntR family protein COG2188 Transcriptional regulators R2601:733.4..734.2 kbp (744 bp) score=40
R2601_05318 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators R2601:907.7..908.8 kbp (1.032 kbp) score=40
R2601_05373 probable transcriptional regulator COG1414 Transcriptional regulator R2601:920.6..921.3 kbp (672 bp) score=40
R2601_05503 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:952.5..953 kbp (486 bp) score=40
R2601_05523 TetR family transcriptional regulatory protein COG1309 Transcriptional regulator R2601:958.6..959.2 kbp (594 bp) score=40
R2601_05533 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:960.4..961.1 kbp (702 bp) score=40
R2601_05763 transcriptional regulator COG0583 Transcriptional regulator R2601:1.007..1.008 Mbp (918 bp) score=40
R2601_05778 transcriptional regulator, GntR family protein COG2186 Transcriptional regulators R2601:1.01..1.011 Mbp (726 bp) score=40
R2601_05978 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:1.057..1.057 Mbp (480 bp) score=40
R2601_06013 probable LysR-family transcriptional regulator COG0583 Transcriptional regulator R2601:1.064..1.065 Mbp (912 bp) score=40
R2601_06018 GntR family transcriptional regulator COG1802 Transcriptional regulators R2601:1.065..1.065 Mbp (681 bp) score=40
R2601_06048 GntR family transcriptional regulator COG1802 Transcriptional regulators R2601:1.07..1.071 Mbp (606 bp) score=40
R2601_06133 transcriptional regulatory protein COG1802 Transcriptional regulators R2601:1.088..1.088 Mbp (690 bp) score=40
R2601_06198 transcriptional regulatory protein COG1414 Transcriptional regulator R2601:1.101..1.102 Mbp (816 bp) score=40
R2601_06203 transcriptional regulatory protein COG1414 Transcriptional regulator R2601:1.102..1.103 Mbp (819 bp) score=40
R2601_06228 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:1.109..1.11 Mbp (486 bp) score=40
R2601_06368 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:1.168..1.169 Mbp (918 bp) score=40
R2601_06393 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:1.172..1.173 Mbp (366 bp) score=40
R2601_06623 Response regulator receiver:Transcriptional regulatory protein, C terminal COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:1.22..1.22 Mbp (660 bp) score=40
R2601_06798 putative transcriptional regulator COG1396 Predicted transcriptional regulators R2601:1.256..1.256 Mbp (375 bp) score=40
R2601_07078 Cu(I)-responsive transcriptional regulator COG0789 Predicted transcriptional regulators R2601:1.31..1.311 Mbp (399 bp) score=40
R2601_07228 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators R2601:1.337..1.337 Mbp (429 bp) score=40
R2601_07503 heavy metal resistance transcriptional regulator Hmrr, MerR family protein COG0789 Predicted transcriptional regulators R2601:1.387..1.388 Mbp (315 bp) score=40
R2601_07688 transcriptional regulatory protein COG0583 Transcriptional regulator R2601:1.427..1.427 Mbp (882 bp) score=40
R2601_07876 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:1.475..1.476 Mbp (945 bp) score=40
R2601_07851 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:1.48..1.48 Mbp (375 bp) score=40
R2601_08096 transcriptional regulator, GntR family protein COG2188 Transcriptional regulators R2601:1.533..1.533 Mbp (756 bp) score=40
R2601_08853 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:1.675..1.676 Mbp (459 bp) score=40
R2601_08913 transcriptional regulator, CarD family protein COG1329 Transcriptional regulators, similar to M. xanthus CarD R2601:1.692..1.693 Mbp (510 bp) score=40
R2601_09153 transcriptional regulator, GntR family protein COG2188 Transcriptional regulators R2601:1.74..1.741 Mbp (807 bp) score=40
R2601_09188 putative transcriptional regulator COG0583 Transcriptional regulator R2601:1.748..1.749 Mbp (540 bp) score=40
R2601_10002 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:1.899..1.9 Mbp (474 bp) score=40
R2601_10564 probable transcriptional regulator COG0583 Transcriptional regulator R2601:2.022..2.023 Mbp (876 bp) score=40
R2601_10599 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:2.029..2.03 Mbp (459 bp) score=40
R2601_10924 probable transcriptional regulator protein, MarR family COG1846 Transcriptional regulators R2601:2.087..2.088 Mbp (438 bp) score=40
R2601_10944 transcriptional regulator PetP COG1846 Transcriptional regulators R2601:2.091..2.092 Mbp (513 bp) score=40
R2601_11534 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators R2601:2.154..2.154 Mbp (315 bp) score=40
R2601_11769 transcriptional regulator, LacI family protein COG1609 Transcriptional regulators R2601:2.252..2.253 Mbp (957 bp) score=40
R2601_11821 Transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:2.262..2.263 Mbp (573 bp) score=40
R2601_12146 negative transcriptional regulator COG2808 Transcriptional regulator R2601:2.332..2.332 Mbp (648 bp) score=40
R2601_12570 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:2.417..2.417 Mbp (420 bp) score=40
R2601_12630 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators R2601:2.428..2.429 Mbp (291 bp) score=40
R2601_12650 transcriptional regulator COG1846 Transcriptional regulators R2601:2.433..2.433 Mbp (432 bp) score=40
R2601_12785 Transcriptional regulator TetR family protein COG1309 Transcriptional regulator R2601:2.456..2.457 Mbp (621 bp) score=40
R2601_12800 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:2.461..2.462 Mbp (921 bp) score=40
R2601_13154 transcriptional regulatory protein COG1846 Transcriptional regulators R2601:2.537..2.538 Mbp (501 bp) score=40
R2601_13209 probable transcriptional regulator protein, GntR family COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs R2601:2.548..2.549 Mbp (1.368 kbp) score=40
R2601_13274 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:2.562..2.563 Mbp (660 bp) score=40
R2601_13344 transcriptional regulator, DeoR family protein COG1349 Transcriptional regulators of sugar metabolism R2601:2.579..2.58 Mbp (774 bp) score=40
R2601_13419 transcriptional regulatory protein COG1846 Transcriptional regulators R2601:2.595..2.596 Mbp (420 bp) score=40
R2601_14005 transcriptional regulator, GntR family protein COG2186 Transcriptional regulators R2601:2.7..2.701 Mbp (714 bp) score=40
R2601_14050 transcriptional regulator COG0789 Predicted transcriptional regulators R2601:2.712..2.712 Mbp (390 bp) score=40
R2601_14895 transcriptional regulator, putative COG1846 Transcriptional regulators R2601:2.887..2.888 Mbp (441 bp) score=40
R2601_15437 Transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:3.013..3.013 Mbp (630 bp) score=40
R2601_15712 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:3.069..3.07 Mbp (642 bp) score=40
R2601_16415 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:3.212..3.213 Mbp (882 bp) score=40
R2601_16425 transcriptional regulator, ArsR family protein COG0640 Predicted transcriptional regulators R2601:3.214..3.214 Mbp (354 bp) score=40
R2601_16640 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:3.253..3.254 Mbp (906 bp) score=40
R2601_16660 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:3.279..3.28 Mbp (861 bp) score=40
R2601_16835 transcriptional regulator/arsenate reductase COG0640 Predicted transcriptional regulators R2601:3.288..3.289 Mbp (795 bp) score=40
R2601_17162 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:3.32..3.321 Mbp (891 bp) score=40
R2601_17117 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:3.332..3.332 Mbp (651 bp) score=40
R2601_17424 RuBisCO operon transcriptional regulator, CbbR COG0583 Transcriptional regulator R2601:3.41..3.411 Mbp (927 bp) score=40
R2601_17704 Transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:3.468..3.469 Mbp (591 bp) score=40
R2601_18123 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:3.551..3.552 Mbp (720 bp) score=40
R2601_18348 transcriptional regulator SoxR COG0640 Predicted transcriptional regulators R2601:3.598..3.599 Mbp (345 bp) score=40
R2601_18498 transcriptional regulator, putative COG1396 Predicted transcriptional regulators R2601:3.624..3.626 Mbp (1.311 kbp) score=40
R2601_18648 transcriptional regulator, AraC family protein COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain R2601:3.656..3.657 Mbp (1.041 kbp) score=40
R2601_18673 transcriptional regulator, AraC family protein COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain R2601:3.663..3.664 Mbp (957 bp) score=40
R2601_18730 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:3.678..3.678 Mbp (693 bp) score=40
R2601_18935 transcriptional regulator, MarR family protein COG1846 Transcriptional regulators R2601:3.719..3.72 Mbp (498 bp) score=40
R2601_19382 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:3.81..3.81 Mbp (456 bp) score=40
R2601_19387 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:3.81..3.811 Mbp (465 bp) score=40
R2601_19412 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:3.815..3.815 Mbp (645 bp) score=40
R2601_19899 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:3.927..3.928 Mbp (891 bp) score=40
R2601_20029 probable transcriptional regulator COG1414 Transcriptional regulator R2601:3.953..3.954 Mbp (777 bp) score=40
R2601_20074 transcriptional regulatory protein COG0583 Transcriptional regulator R2601:3.962..3.963 Mbp (927 bp) score=40
R2601_20144 transcriptional regulatory protein COG1309 Transcriptional regulator R2601:3.977..3.977 Mbp (630 bp) score=40
R2601_20169 transcriptional regulator COG1846 Transcriptional regulators R2601:3.985..3.986 Mbp (549 bp) score=40
R2601_20229 transcriptional regulator, BetI COG1309 Transcriptional regulator R2601:3.997..3.998 Mbp (576 bp) score=40
R2601_20326 transcriptional regulator, ROK family protein COG1940 Transcriptional regulator/sugar kinase R2601:4.029..4.03 Mbp (1.173 kbp) score=40
R2601_20396 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:4.034..4.035 Mbp (1.029 kbp) score=40
R2601_20446 transcriptional regulator, GntR family protein COG2188 Transcriptional regulators R2601:4.046..4.047 Mbp (726 bp) score=40
R2601_20741 LysR-family transcriptional regulator COG0583 Transcriptional regulator R2601:4.118..4.119 Mbp (723 bp) score=40
R2601_20966 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:4.169..4.17 Mbp (873 bp) score=40
R2601_21286 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:4.237..4.238 Mbp (963 bp) score=40
R2601_21316 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:4.241..4.242 Mbp (903 bp) score=40
R2601_21902 transcriptional regulatory protein COG1846 Transcriptional regulators R2601:4.362..4.362 Mbp (453 bp) score=40
R2601_22382 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:4.473..4.473 Mbp (456 bp) score=40
R2601_22512 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:4.503..4.504 Mbp (906 bp) score=40
R2601_22696 transcriptional regulator, GntR family protein COG1802 Transcriptional regulators R2601:4.539..4.54 Mbp (486 bp) score=40
R2601_23086 probable GntR-family transcriptional regulator COG1802 Transcriptional regulators R2601:4.541..4.541 Mbp (678 bp) score=40
R2601_23113 putative LysR-family transcriptional regulator COG0583 Transcriptional regulator R2601:4.604..4.605 Mbp (912 bp) score=40
R2601_23183 putative GntR-family transcriptional regulator COG1802 Transcriptional regulators R2601:4.618..4.618 Mbp (666 bp) score=40
R2601_23233 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:4.629..4.63 Mbp (897 bp) score=40
R2601_24849 transcriptional regulator, AraC family protein COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain R2601:4.955..4.956 Mbp (1.011 kbp) score=40
R2601_25406 transcriptional regulator, GntR family protein COG2186 Transcriptional regulators R2601:5.069..5.07 Mbp (750 bp) score=40
R2601_25531 transcriptional regulator MetR COG0583 Transcriptional regulator R2601:5.098..5.099 Mbp (906 bp) score=40
R2601_25636 Transcriptional regulator, TetR family protein COG1309 Transcriptional regulator R2601:5.117..5.117 Mbp (615 bp) score=40
R2601_25666 transcriptional regulator, GntR family protein COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs R2601:5.122..5.123 Mbp (1.425 kbp) score=40
R2601_25761 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators R2601:5.143..5.143 Mbp (372 bp) score=40
R2601_25766 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators R2601:5.144..5.144 Mbp (399 bp) score=40
R2601_26091 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:5.207..5.207 Mbp (486 bp) score=40
R2601_26366 transcriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators R2601:5.271..5.272 Mbp (426 bp) score=40
R2601_26486 redox-sensitive transcriptional regulator-activator protein COG0789 Predicted transcriptional regulators R2601:5.296..5.297 Mbp (435 bp) score=40
R2601_26776 transcriptional regulator COG1959 Predicted transcriptional regulator R2601:5.35..5.351 Mbp (567 bp) score=40
R2601_26781 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:5.351..5.351 Mbp (156 bp) score=40
R2601_26786 putative transcriptional regulator LYSR-type COG0583 Transcriptional regulator R2601:5.352..5.352 Mbp (330 bp) score=40
R2601_27051 Transcriptional regulator, AsnC family protein COG1522 Transcriptional regulators R2601:5.411..5.411 Mbp (462 bp) score=40
R2601_27091 transcriptional regulator, DeoR family protein COG1349 Transcriptional regulators of sugar metabolism R2601:5.418..5.419 Mbp (768 bp) score=40
R2601_27298 transcriptional regulator, LysR family protein COG0583 Transcriptional regulator R2601:5.463..5.464 Mbp (945 bp) score=40
R2601_27328 transcriptional regulatory protein COG1522 Transcriptional regulators R2601:5.472..5.473 Mbp (462 bp) score=40
R2601_00685 Bacterial regulatory protein, GntR family COG1802 Transcriptional regulators R2601:140.2..140.9 kbp (681 bp) score=30
R2601_00715 transcription regulator COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain R2601:145.5..146.4 kbp (945 bp) score=30
R2601_00785 two component, sigma54 specific, transcriptional regulator, Fis family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:163.1..163.5 kbp (411 bp) score=30
R2601_00805 Sigma-54 dependent transcriptional regulator COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:167.8..169.1 kbp (1.305 kbp) score=30
R2601_00980 Bacterial regulatory protein, DeoR family COG1349 Transcriptional regulators of sugar metabolism R2601:207.9..208.7 kbp (768 bp) score=30
R2601_01090 putative transcription regulator protein COG1414 Transcriptional regulator R2601:233.9..234.7 kbp (804 bp) score=30
R2601_01793 putative transcription regulator protein COG1309 Transcriptional regulator R2601:382.8..383.4 kbp (663 bp) score=30
R2601_02113 Putative AsnC (lrp)-family transcriptional activator COG1522 Transcriptional regulators R2601:452.5..453 kbp (495 bp) score=30
R2601_03423 regulatory protein, LysR:LysR, substrate-binding COG0583 Transcriptional regulator R2601:665.2..666.2 kbp (1.038 kbp) score=30
R2601_04318 transcriptional regulator, LuxR family protein COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain R2601:735.7..736.5 kbp (837 bp) score=30
R2601_04858 putative transcriptional regulator protein COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain R2601:814..814.7 kbp (726 bp) score=30
R2601_05218 putative GntR-family transcription regulator COG1802 Transcriptional regulators R2601:882.6..883.3 kbp (657 bp) score=30
R2601_05703 regulatory protein GntR, HTH COG1802 Transcriptional regulators R2601:991.5..992.1 kbp (669 bp) score=30
R2601_06453 regulatory protein, MarR COG1846 Transcriptional regulators R2601:1.184..1.185 Mbp (468 bp) score=30
R2601_06498 pca operon transcriptional activator PcaQ COG0583 Transcriptional regulator R2601:1.194..1.195 Mbp (405 bp) score=30
R2601_06848 regulatory protein, ArsR COG0640 Predicted transcriptional regulators R2601:1.268..1.268 Mbp (351 bp) score=30
R2601_09220 leucine-responsive regulatory protein, putative COG1522 Transcriptional regulators R2601:1.755..1.756 Mbp (501 bp) score=30
R2601_09787 Cell cycle transcriptional regulator CtrA COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:1.853..1.854 Mbp (696 bp) score=30
R2601_10159 regulatory protein GntR, HTH COG1802 Transcriptional regulators R2601:1.938..1.938 Mbp (642 bp) score=30
R2601_13144 pca operon transcriptional activator PcaQ COG0583 Transcriptional regulator R2601:2.525..2.526 Mbp (525 bp) score=30
R2601_13159 putative transcription regulator protein COG1846 Transcriptional regulators R2601:2.538..2.538 Mbp (477 bp) score=30
R2601_16540 transcriptional regulator, winged helix family protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:3.237..3.238 Mbp (669 bp) score=30
R2601_16605 transcriptional regulator, Crp/Fnr family protein COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases R2601:3.246..3.247 Mbp (705 bp) score=30
R2601_17469 putative transcription regulator protein COG1349 Transcriptional regulators of sugar metabolism R2601:3.421..3.422 Mbp (852 bp) score=30
R2601_18023 putative transcriptional regulator COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases R2601:3.532..3.533 Mbp (672 bp) score=30
R2601_18663 probable LysR-family transcriptional activator COG0583 Transcriptional regulator R2601:3.659..3.66 Mbp (873 bp) score=30
R2601_18990 proline dehydrogenase transcriptional activator COG1522 Transcriptional regulators R2601:3.729..3.729 Mbp (489 bp) score=30
R2601_19704 regulatory protein, IclR COG1414 Transcriptional regulator R2601:3.885..3.885 Mbp (618 bp) score=30
R2601_19869 probable transcription regulator protein COG0583 Transcriptional regulator R2601:3.922..3.923 Mbp (897 bp) score=30
R2601_21877 transcriptional activator, Baf family protein COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor R2601:4.357..4.357 Mbp (780 bp) score=30
R2601_22232 Putative regulatory protein, GntR family COG2186 Transcriptional regulators R2601:4.441..4.442 Mbp (726 bp) score=30
R2601_22237 Putative regulatory protein, GntR family COG1802 Transcriptional regulators R2601:4.442..4.443 Mbp (888 bp) score=30
R2601_22397 C4-dicarboxylate transport transcriptional regulatory protein COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:4.476..4.479 Mbp (2.526 kbp) score=30
R2601_23590 probable transcription regulator protein COG0583 Transcriptional regulator R2601:4.689..4.69 Mbp (891 bp) score=30
R2601_23630 probable transcription regulator protein COG0583 Transcriptional regulator R2601:4.698..4.699 Mbp (900 bp) score=30
R2601_24370 regulatory protein, LysR:LysR, substrate-binding COG0583 Transcriptional regulator R2601:4.845..4.845 Mbp (285 bp) score=30
R2601_24465 C4-dicarboxylate transport transcriptional regulatory protein DctD COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:4.865..4.867 Mbp (1.323 kbp) score=30
R2601_24634 putative transcription regulator protein COG1609 Transcriptional regulators R2601:4.91..4.911 Mbp (1.071 kbp) score=30
R2601_24944 phosphate regulon transcriptional regulatory protein PhoB COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:4.974..4.975 Mbp (690 bp) score=30
R2601_26026 trancriptional regulator, MerR family protein COG0789 Predicted transcriptional regulators R2601:5.191..5.192 Mbp (1.113 kbp) score=30
R2601_26126 transcriptional regulator, Crp-Fnr family protein COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases R2601:5.215..5.216 Mbp (654 bp) score=30
R2601_26506 Operon regulator SmoC COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain R2601:5.299..5.3 Mbp (948 bp) score=30
R2601_00155 Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:31.34..32.01 kbp (669 bp) score=20
R2601_00240 COG1414 Transcriptional regulator R2601:51.05..51.81 kbp (756 bp) score=20
R2601_00250 SpoVT/AbrB-like cell growth regulatory protein COG2336 Growth regulator R2601:52.21..52.44 kbp (228 bp) score=20
R2601_00320 COG1475 Predicted transcriptional regulators R2601:66.36..67.31 kbp (948 bp) score=20
R2601_00355 Predicted transcriptional regulator R2601:72.21..72.48 kbp (276 bp) score=20
R2601_00360 putative mucR family transcriptional regulatory protein R2601:72.6..73.03 kbp (429 bp) score=20
R2601_00435 DNA-binding response regulator CtrA COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:87.59..88.36 kbp (777 bp) score=20
R2601_00600 COG1802 Transcriptional regulators R2601:115.6..116 kbp (430 bp) score=20
R2601_00800 COG1475 Predicted transcriptional regulators R2601:166.2..167.3 kbp (1.098 kbp) score=20
R2601_00940 Periplasmic binding protein/LacI transcriptional regulator R2601:198.1..199 kbp (951 bp) score=20
R2601_00975 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain R2601:207..207.9 kbp (936 bp) score=20
R2601_01370 COG1414 Transcriptional regulator R2601:293.6..294.5 kbp (843 bp) score=20
R2601_01828 probable two-component response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:390.4..391.2 kbp (735 bp) score=20
R2601_01863 transcriptional regulator, AraC family protein R2601:396.6..397.6 kbp (1.047 kbp) score=20
R2601_02003 transcriptional regulator, AraC family protein R2601:426.5..427.4 kbp (885 bp) score=20
R2601_02328 putative transcriptional regulator R2601:497.2..498.1 kbp (906 bp) score=20
R2601_03083 transcriptional regulator, AraC family protein R2601:639..639.9 kbp (942 bp) score=20
R2601_04103 COG1802 Transcriptional regulators R2601:721.9..722.8 kbp (843 bp) score=20
R2601_04818 two-component system, regulatory protein COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:806..806.7 kbp (681 bp) score=20
R2601_04883 COG1475 Predicted transcriptional regulators R2601:818.3..819.2 kbp (981 bp) score=20
R2601_05053 Sigma-54 dependent response regulator COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:849.4..850.7 kbp (1.365 kbp) score=20
R2601_05803 COG1737 Transcriptional regulators R2601:1.015..1.016 Mbp (849 bp) score=20
R2601_05988 COG1396 Predicted transcriptional regulators R2601:1.059..1.059 Mbp (267 bp) score=20
R2601_06143 putative two-component response regulator COG4566 Response regulator R2601:1.091..1.091 Mbp (630 bp) score=20
R2601_06253 COG1414 Transcriptional regulator R2601:1.115..1.116 Mbp (1.602 kbp) score=20
R2601_06348 COG1475 Predicted transcriptional regulators R2601:1.135..1.136 Mbp (1.107 kbp) score=20
R2601_06478 COG1414 Transcriptional regulator R2601:1.191..1.192 Mbp (795 bp) score=20
R2601_06593 COG1475 Predicted transcriptional regulators R2601:1.212..1.213 Mbp (930 bp) score=20
R2601_06603 COG1475 Predicted transcriptional regulators R2601:1.215..1.217 Mbp (2.172 kbp) score=20
R2601_06863 COG1386 Predicted transcriptional regulator containing the HTH domain R2601:1.271..1.271 Mbp (597 bp) score=20
R2601_06908 COG1475 Predicted transcriptional regulators R2601:1.279..1.28 Mbp (957 bp) score=20
R2601_06988 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:1.292..1.293 Mbp (723 bp) score=20
R2601_07168 COG1321 Mn-dependent transcriptional regulator R2601:1.329..1.329 Mbp (351 bp) score=20
R2601_07453 COG1475 Predicted transcriptional regulators R2601:1.378..1.379 Mbp (1.041 kbp) score=20
R2601_07961 COG1396 Predicted transcriptional regulators R2601:1.489..1.489 Mbp (639 bp) score=20
R2601_08151 two-component response regulator protein COG3707 Response regulator with putative antiterminator output domain R2601:1.521..1.521 Mbp (585 bp) score=20
R2601_08361 COG1396 Predicted transcriptional regulators R2601:1.613..1.614 Mbp (555 bp) score=20
R2601_08791 transcriptional regulator, Fur family protein R2601:1.665..1.665 Mbp (384 bp) score=20
R2601_09113 transcriptional regulator R2601:1.733..1.734 Mbp (1.197 kbp) score=20
R2601_09210 COG1695 Predicted transcriptional regulators R2601:1.751..1.753 Mbp (2.079 kbp) score=20
R2601_10419 COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains R2601:1.994..1.995 Mbp (471 bp) score=20
R2601_10524 transcriptional activator protein FnrL COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases R2601:2.016..2.017 Mbp (747 bp) score=20
R2601_10664 autoinducer-binding transcriptional regulator LuxR R2601:2.042..2.043 Mbp (672 bp) score=20
R2601_10949 DNA-binding response regulator PetR COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:2.092..2.092 Mbp (702 bp) score=20
R2601_10984 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:2.099..2.099 Mbp (429 bp) score=20
R2601_10989 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:2.099..2.099 Mbp (261 bp) score=20
R2601_11124 DNA-binding response regulator, LuxR family protein COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain R2601:2.125..2.126 Mbp (615 bp) score=20
R2601_11149 response regulator COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:2.132..2.132 Mbp (369 bp) score=20
R2601_11424 transcriptional regulator, LuxR family protein R2601:2.177..2.178 Mbp (804 bp) score=20
R2601_11334 molybdenum-binding transcriptional regulator, ModE family protein R2601:2.193..2.194 Mbp (396 bp) score=20
R2601_11724 COG1396 Predicted transcriptional regulators R2601:2.242..2.243 Mbp (696 bp) score=20
R2601_11774 Crp-Fnr family transciptional regulator COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases R2601:2.253..2.254 Mbp (735 bp) score=20
R2601_12660 COG1309 Transcriptional regulator R2601:2.435..2.436 Mbp (573 bp) score=20
R2601_12745 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:2.45..2.451 Mbp (702 bp) score=20
R2601_12855 COG1349 Transcriptional regulators of sugar metabolism R2601:2.475..2.476 Mbp (768 bp) score=20
R2601_12900 COG2186 Transcriptional regulators R2601:2.481..2.482 Mbp (771 bp) score=20
R2601_12945 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII R2601:2.487..2.487 Mbp (339 bp) score=20
R2601_13005 two-component response regulator COG4566 Response regulator R2601:2.505..2.506 Mbp (642 bp) score=20
R2601_13114 transcriptional regulatory protein R2601:2.53..2.531 Mbp (864 bp) score=20
R2601_13229 COG0583 Transcriptional regulator R2601:2.552..2.553 Mbp (774 bp) score=20
R2601_13364 two-component response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:2.584..2.585 Mbp (789 bp) score=20
R2601_13404 COG1349 Transcriptional regulators of sugar metabolism R2601:2.593..2.594 Mbp (840 bp) score=20
R2601_13409 transcriptional regulator, AraC family protein R2601:2.594..2.594 Mbp (867 bp) score=20
R2601_13729 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:2.654..2.655 Mbp (717 bp) score=20
R2601_13870 COG1678 Putative transcriptional regulator R2601:2.674..2.674 Mbp (90 bp) score=20
R2601_13875 COG1678 Putative transcriptional regulator R2601:2.674..2.675 Mbp (473 bp) score=20
R2601_13935 transcriptional regulatory protein R2601:2.687..2.687 Mbp (561 bp) score=20
R2601_14715 COG1475 Predicted transcriptional regulators R2601:2.853..2.854 Mbp (912 bp) score=20
R2601_14735 COG1420 Transcriptional regulator of heat shock gene R2601:2.856..2.857 Mbp (1.065 kbp) score=20
R2601_14985 photosynthetic apparatus regulatory protein RegA COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain R2601:2.908..2.909 Mbp (555 bp) score=20
R2601_15120 DNA-binding response regulator, LuxR family protein COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain R2601:2.939..2.94 Mbp (615 bp) score=20
R2601_15260 COG1959 Predicted transcriptional regulator R2601:2.98..2.98 Mbp (438 bp) score=20
R2601_15632 COG3604 Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains R2601:3.051..3.053 Mbp (1.677 kbp) score=20
R2601_16250 HupR response regulator COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:3.181..3.182 Mbp (1.491 kbp) score=20
R2601_16655 COG1309 Transcriptional regulator R2601:3.28..3.281 Mbp (651 bp) score=20
R2601_16885 DNA-binding response regulator ChvI COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:3.297..3.298 Mbp (702 bp) score=20
R2601_17529 COG1309 Transcriptional regulator R2601:3.435..3.436 Mbp (648 bp) score=20
R2601_18198 COG0583 Transcriptional regulator R2601:3.57..3.571 Mbp (876 bp) score=20
R2601_18503 response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:3.626..3.626 Mbp (360 bp) score=20
R2601_18820 transcriptional regulator R2601:3.698..3.699 Mbp (891 bp) score=20
R2601_18945 COG1396 Predicted transcriptional regulators R2601:3.72..3.721 Mbp (396 bp) score=20
R2601_19070 COG1522 Transcriptional regulators R2601:3.745..3.746 Mbp (240 bp) score=20
R2601_19814 ISPsy20, transposase IstB, transcriptional regulator, LysR family - fusion R2601:3.912..3.913 Mbp (603 bp) score=20
R2601_19984 DNA-binding response regulator COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:3.944..3.944 Mbp (669 bp) score=20
R2601_20336 COG1737 Transcriptional regulators R2601:4.027..4.028 Mbp (858 bp) score=20
R2601_20611 COG1609 Transcriptional regulators R2601:4.086..4.087 Mbp (1.032 kbp) score=20
R2601_20871 transcriptional regulator, AraC family protein R2601:4.153..4.154 Mbp (1.005 kbp) score=20
R2601_20976 COG1396 Predicted transcriptional regulators R2601:4.172..4.172 Mbp (384 bp) score=20
R2601_21472 COG2345 Predicted transcriptional regulator R2601:4.274..4.274 Mbp (600 bp) score=20
R2601_21622 DNA-binding response regulator, LuxR family protein COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain R2601:4.308..4.309 Mbp (645 bp) score=20
R2601_21887 COG1396 Predicted transcriptional regulators R2601:4.359..4.36 Mbp (570 bp) score=20
R2601_22207 COG1695 Predicted transcriptional regulators R2601:4.437..4.438 Mbp (543 bp) score=20
R2601_22986 COG1396 Predicted transcriptional regulators R2601:4.55..4.55 Mbp (432 bp) score=20
R2601_22931 COG1396 Predicted transcriptional regulators R2601:4.556..4.556 Mbp (300 bp) score=20
R2601_23273 transcriptional regulator, LuxR family protein R2601:4.633..4.634 Mbp (528 bp) score=20
R2601_23830 DNA-binding response regulator CtrA COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:4.744..4.745 Mbp (540 bp) score=20
R2601_23885 COG2932 Predicted transcriptional regulator R2601:4.751..4.751 Mbp (438 bp) score=20
R2601_24120 DNA-binding response regulator CtrA COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:4.794..4.795 Mbp (174 bp) score=20
R2601_24385 COG0583 Transcriptional regulator R2601:4.848..4.849 Mbp (423 bp) score=20
R2601_24729 nitrogen regulatory protein P-II COG0347 Nitrogen regulatory protein PII R2601:4.927..4.928 Mbp (339 bp) score=20
R2601_24754 COG1733 Predicted transcriptional regulators R2601:4.935..4.935 Mbp (423 bp) score=20
R2601_24809 COG1396 Predicted transcriptional regulators R2601:4.947..4.947 Mbp (621 bp) score=20
R2601_24939 phosphate transport system regulatory protein PhoU COG0704 Phosphate uptake regulator R2601:4.973..4.974 Mbp (726 bp) score=20
R2601_24964 autoinducer-binding transcriptional regulator, LuxR family protein R2601:4.978..4.979 Mbp (768 bp) score=20
R2601_25021 DNA-binding response regulator, LuxR family protein COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain R2601:4.988..4.989 Mbp (705 bp) score=20
R2601_25126 transcriptional regulator, AraC family protein R2601:5.011..5.011 Mbp (771 bp) score=20
R2601_25706 cAMP-binding protein - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinase COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases R2601:5.129..5.13 Mbp (696 bp) score=20
R2601_25736 COG1737 Transcriptional regulators R2601:5.139..5.14 Mbp (825 bp) score=20
R2601_25841 COG2378 Predicted transcriptional regulator R2601:5.158..5.159 Mbp (672 bp) score=20
R2601_25871 COG1396 Predicted transcriptional regulators R2601:5.162..5.163 Mbp (393 bp) score=20
R2601_26041 COG1386 Predicted transcriptional regulator containing the HTH domain R2601:5.195..5.195 Mbp (771 bp) score=20
R2601_26246 nitrogen assimilation regulatory protein NtrX COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:5.242..5.244 Mbp (1.419 kbp) score=20
R2601_26716 COG1396 Predicted transcriptional regulators R2601:5.338..5.338 Mbp (459 bp) score=20
R2601_26886 COG1959 Predicted transcriptional regulator R2601:5.375..5.375 Mbp (462 bp) score=20
R2601_27146 COG1396 Predicted transcriptional regulators R2601:5.431..5.433 Mbp (1.392 kbp) score=20
R2601_00010 putative monoamine oxidase regulatory protein R2601:259..702 bp (444 bp) score=10
R2601_00285 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) R2601:61.26..62.08 kbp (825 bp) score=10
R2601_00350 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:71.38..72.05 kbp (666 bp) score=10
R2601_04813 Response regulator receiver:ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine R2601:804.4..806 kbp (1.587 kbp) score=10
R2601_05133 COG0425 Predicted redox protein, regulator of disulfide bond formation R2601:866.1..866.4 kbp (264 bp) score=10
R2601_05443 sensor histidine kinase with multiple PAS and a response regulator receiver domain R2601:936.7..938.7 kbp (2.055 kbp) score=10
R2601_07533 regulatory protein R2601:1.391..1.392 Mbp (1.353 kbp) score=10
R2601_08571 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) R2601:1.626..1.628 Mbp (1.962 kbp) score=10
R2601_09023 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) R2601:1.714..1.715 Mbp (825 bp) score=10
R2601_09400 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) R2601:1.783..1.784 Mbp (285 bp) score=10
R2601_09405 chemotaxis response regulator, CheY1 R2601:1.784..1.784 Mbp (375 bp) score=10
R2601_09425 Chemotaxis response regulator, CheY2 R2601:1.788..1.788 Mbp (387 bp) score=10
R2601_09435 COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain R2601:1.788..1.789 Mbp (1.056 kbp) score=10
R2601_09997 sensor histidine kinase/response regulator R2601:1.897..1.899 Mbp (1.575 kbp) score=10
R2601_10117 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) R2601:1.928..1.928 Mbp (477 bp) score=10
R2601_10384 ATP phosphoribosyltransferase regulatory subunit R2601:1.989..1.99 Mbp (1.089 kbp) score=10
R2601_12740 sensory box histidine kinase/response regulator R2601:2.448..2.45 Mbp (1.881 kbp) score=10
R2601_13000 two-component hybrid sensor and regulator R2601:2.503..2.505 Mbp (2.319 kbp) score=10
R2601_13424 nitrile hydratase regulator R2601:2.596..2.597 Mbp (1.029 kbp) score=10
R2601_14810 response regulator R2601:2.872..2.873 Mbp (1.248 kbp) score=10
R2601_14980 regulatory protein SenC R2601:2.908..2.908 Mbp (621 bp) score=10
R2601_15105 sensory box histidine kinase/response regulator R2601:2.934..2.937 Mbp (2.439 kbp) score=10
R2601_15472 ADA regulatory protein R2601:3.022..3.023 Mbp (837 bp) score=10
R2601_15522 PTS IIA-like nitrogen-regulatory protein PtsN R2601:3.03..3.031 Mbp (465 bp) score=10
R2601_15985 COG3629 DNA-binding transcriptional activator of the SARP family R2601:3.126..3.128 Mbp (1.524 kbp) score=10
R2601_16570 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:3.241..3.242 Mbp (651 bp) score=10
R2601_17589 two-component hybrid sensor and regulator R2601:3.448..3.45 Mbp (1.965 kbp) score=10
R2601_17594 two-component response regulator R2601:3.45..3.45 Mbp (369 bp) score=10
R2601_17729 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) R2601:3.473..3.474 Mbp (468 bp) score=10
R2601_17734 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) R2601:3.474..3.474 Mbp (483 bp) score=10
R2601_18178 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) R2601:3.565..3.566 Mbp (687 bp) score=10
R2601_18353 regulatory protein SoxS R2601:3.599..3.599 Mbp (447 bp) score=10
R2601_18710 response regulator, hypothetical R2601:3.672..3.673 Mbp (384 bp) score=10
R2601_18715 COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain R2601:3.673..3.676 Mbp (3.465 kbp) score=10
R2601_18760 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:3.683..3.684 Mbp (414 bp) score=10
R2601_18810 regulatory protein, putative R2601:3.695..3.697 Mbp (2.091 kbp) score=10
R2601_20264 sensory box histidine kinase/response regulator R2601:4.007..4.007 Mbp (618 bp) score=10
R2601_20671 COG3629 DNA-binding transcriptional activator of the SARP family R2601:4.098..4.1 Mbp (1.596 kbp) score=10
R2601_21046 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) R2601:4.185..4.186 Mbp (909 bp) score=10
R2601_21341 COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain R2601:4.245..4.246 Mbp (1.413 kbp) score=10
R2601_21432 putative acetoin catabolism regulatory protein R2601:4.262..4.263 Mbp (1.74 kbp) score=10
R2601_21482 Putative negative amidase regulator, AmiC R2601:4.276..4.277 Mbp (1.101 kbp) score=10
R2601_21487 COG3707 Response regulator with putative antiterminator output domain R2601:4.277..4.278 Mbp (603 bp) score=10
R2601_21602 COG0440 Acetolactate synthase, small (regulatory) subunit R2601:4.303..4.304 Mbp (564 bp) score=10
R2601_22437 COG3279 Response regulator of the LytR/AlgR family R2601:4.485..4.486 Mbp (900 bp) score=10
R2601_22916 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain R2601:4.557..4.557 Mbp (405 bp) score=10
R2601_23333 sensory box sensor histidine kianse/response regulator R2601:4.646..4.648 Mbp (1.786 kbp) score=10
R2601_25141 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) R2601:5.014..5.015 Mbp (594 bp) score=10
R2601_25241 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) R2601:5.032..5.033 Mbp (696 bp) score=10
R2601_26196 COG1764 Predicted redox protein, regulator of disulfide bond formation R2601:5.231..5.231 Mbp (426 bp) score=10
R2601_26256 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains R2601:5.246..5.247 Mbp (1.374 kbp) score=10
R2601_26626 two-component response regulator R2601:5.318..5.319 Mbp (801 bp) score=10
R2601_27166 COG3023 Negative regulator of beta-lactamase expression R2601:5.435..5.436 Mbp (696 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70