Roseobase: Phaeobacter gallaeciensis DSM 17395

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: PGA1:300000..400000, PGA1_c31430, PGA1_c06840, PGA1_78p00010, PGA1_65p00010, PGA1_262p00010, aatA, YP_006574357, transcriptional activator protein, QNLFQVEGGQLAITATCLDREARQTLSCDTSDAWSFVMNGHRVMKVTAGLSGTVTIEH.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 2392 regions match your request.
Search results are limited to 1000 hits; list may be incomplete.
Matches on PGA1
overview_PGA1
raiR transcriptional activator protein RaiR PGA1:374.7..375.4 kbp (720 bp) score=30
PGA1_c15590 transcriptional activator protein PGA1:1.621..1.621 Mbp (756 bp) score=30
fnrL transcriptional activator protein FnrL PGA1:3.151..3.151 Mbp (741 bp) score=30
PGA1_c00330 protein imuB-like protein PGA1:37.3..38.6 kbp (1.302 kbp) score=20
chvI transcriptional regulatory protein ChvI PGA1:108.6..109.3 kbp (702 bp) score=20
PGA1_c02490 sporulation protein R-like protein PGA1:232.3..233.8 kbp (1.479 kbp) score=20
PGA1_c03210 branched-chain amino acid transport protein azlD-like protein PGA1:308.4..308.7 kbp (336 bp) score=20
PGA1_c03220 branched-chain amino acid transport protein azlC-like protein PGA1:308.7..309.4 kbp (726 bp) score=20
PGA1_c03300 glyoxalase/bleomycin resistance protein domain-containing protein PGA1:315.8..316.2 kbp (384 bp) score=20
soxR1 redox-sensitive transcriptional activator PGA1:316.3..316.8 kbp (495 bp) score=20
PGA1_c03380 glycine cleavage system transcriptional activator PGA1:324.3..325.2 kbp (882 bp) score=20
thiol disulfide interchange protein tlpA-like protein PGA1:330.4..331 kbp (588 bp) score=20
PGA1_c03510 protein insertion permease FtsX-like protein PGA1:338.7..339.6 kbp (900 bp) score=20
PGA1_c04000 nitrogen fixation protein nifU-like protein PGA1:386.7..387.2 kbp (564 bp) score=20
PGA1_c04030 phenylacetic acid degradation protein paaA-like protein PGA1:388.9..389.7 kbp (768 bp) score=20
PGA1_c04720 outer membrane protein OmpA-domain containing protein PGA1:464.6..465.2 kbp (552 bp) score=20
PGA1_c04760 magnesium and cobalt efflux protein corC-like protein PGA1:467.3..468.2 kbp (900 bp) score=20
PGA1_c05260 exopolysaccharide production protein ExoY-like protein PGA1:521.7..522.5 kbp (726 bp) score=20
PGA1_c05290 polysaccharide biosynthesis protein ExoT-like protein PGA1:525..526.4 kbp (1.365 kbp) score=20
PGA1_c06090 type II secretion system protein F-like protein PGA1:622.9..623.8 kbp (981 bp) score=20
PGA1_c06100 type II secretion system protein F-like protein PGA1:623.9..624.8 kbp (969 bp) score=20
PGA1_c06130 outer membrane protein OmpA-like protein PGA1:627.7..628.4 kbp (627 bp) score=20
PGA1_c06150 Flp pilus assembly protein CpaB-like protein PGA1:630..630.9 kbp (861 bp) score=20
nusB N utilization substance protein B-like protein PGA1:923.7..924.2 kbp (492 bp) score=20
tatA independent protein translocase protein TatA PGA1:1.108..1.108 Mbp (219 bp) score=20
tatB sec-independent protein translocase protein TatB PGA1:1.108..1.108 Mbp (486 bp) score=20
tatC sec-independent protein translocase protein TatC PGA1:1.108..1.109 Mbp (969 bp) score=20
PGA1_c10830 colicin V production protein-like protein PGA1:1.119..1.119 Mbp (555 bp) score=20
PGA1_c11740 rhomboid protein-like protein PGA1:1.215..1.216 Mbp (777 bp) score=20
PGA1_c11760 proline dehydrogenase transcriptional activator PGA1:1.22..1.22 Mbp (474 bp) score=20
PGA1_c12490 heat shock protein (HSP 70)-like protein PGA1:1.297..1.298 Mbp (1.251 kbp) score=20
PGA1_c13310 cysteine desulfuration protein sufE-like protein PGA1:1.376..1.376 Mbp (414 bp) score=20
PGA1_c13340 hypothetical protein Tnseq:Accessory protein for co(II)balamin reduction (DUF1638) (EC:2.1.1.13) PGA1:1.378..1.378 Mbp (726 bp) score=20
dctD1 C4-dicarboxylate transport transcriptional regulatory protein DctD PGA1:1.388..1.389 Mbp (1.338 kbp) score=20
PGA1_c15720 glycine cleavage system transcriptional activator PGA1:1.632..1.633 Mbp (912 bp) score=20
phoB phosphate regulon transcriptional regulatory protein PhoB PGA1:1.633..1.634 Mbp (690 bp) score=20
PGA1_c15800 phosphate regulon sensor protein phoR-like protein PGA1:1.64..1.641 Mbp (1.041 kbp) score=20
PGA1_c16130 lipoprotein-releasing system, ATP-binding protein PGA1:1.673..1.673 Mbp (711 bp) score=20
PGA1_c16140 lipoprotein transport protein PGA1:1.673..1.676 Mbp (2.46 kbp) score=20
PGA1_c17900 bacterial type IV pilus assembly (PilZ) protein-like protein PGA1:1.871..1.872 Mbp (1.014 kbp) score=20
secF protein-export membrane protein SecF PGA1:1.962..1.963 Mbp (969 bp) score=20
secD protein-export membrane protein SecD PGA1:1.963..1.965 Mbp (1.662 kbp) score=20
PGA1_c18930 preprotein translocase YajC-like protein PGA1:1.965..1.965 Mbp (285 bp) score=20
PGA1_c19710 alginate biosynthesis protein algA-like protein PGA1:2.046..2.048 Mbp (1.35 kbp) score=20
dctD2 C4-dicarboxylate transport transcriptional regulatory protein DctD PGA1:2.145..2.146 Mbp (1.236 kbp) score=20
PGA1_c20850 methyl-accepting chemotaxis protein-like protein PGA1:2.161..2.162 Mbp (642 bp) score=20
lolD lipoprotein-releasing system ATP-binding protein LolD PGA1:2.217..2.218 Mbp (714 bp) score=20
lolC lipoprotein-releasing system transmembrane protein LolC PGA1:2.218..2.219 Mbp (1.293 kbp) score=20
PGA1_c21790 fumarate reductase/succinate dehydrogenase flavoprotein-like protein PGA1:2.259..2.261 Mbp (1.671 kbp) score=20
PGA1_c22620 signal transduction protein, FIST domain protein PGA1:2.345..2.346 Mbp (1.254 kbp) score=20
PGA1_c23240 protein hipA-like protein PGA1:2.412..2.413 Mbp (1.047 kbp) score=20
PGA1_c23890 preprotein translocase secG-like protein PGA1:2.493..2.493 Mbp (363 bp) score=20
PGA1_c23960 tRNA-modifying protein ygfZ-like protein PGA1:2.502..2.503 Mbp (741 bp) score=20
PGA1_c24690 protein CsaA-like protein PGA1:2.576..2.576 Mbp (339 bp) score=20
chrR transcriptional activator ChrR PGA1:2.866..2.866 Mbp (636 bp) score=20
PGA1_c27610 transcriptional regulatory protein, containing sigma-54 interaction domain PGA1:2.876..2.878 Mbp (1.362 kbp) score=20
PGA1_c28960 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC-like protein PGA1:3.038..3.039 Mbp (699 bp) score=20
PGA1_c28980 glyoxalase/bleomycin resistance protein/dioxygenase domain-containing protein PGA1:3.04..3.041 Mbp (417 bp) score=20
PGA1_c29030 AraC family transcriptional regulator related to methylated-DNA-[protein]-cysteine S-methyltransferase PGA1:3.043..3.044 Mbp (858 bp) score=20
PGA1_c29170 outer memrane protein OmpA-like protein PGA1:3.054..3.055 Mbp (981 bp) score=20
PGA1_c29900 protein slyX-like protein PGA1:3.127..3.127 Mbp (195 bp) score=20
rpsU1 protein RpsU related to ubiquinone biosynthesis protein COQ9 PGA1:3.173..3.173 Mbp (723 bp) score=20
PGA1_c31170 phosphotyrosine protein phosphatase-like protein PGA1:3.254..3.255 Mbp (459 bp) score=20
PGA1_c33220 hemimethylated DNA-binding protein, YccV-like protein PGA1:3.482..3.482 Mbp (327 bp) score=20
PGA1_c33260 protein VisC-like protein PGA1:3.484..3.485 Mbp (1.227 kbp) score=20
PGA1_c33630 malonyl CoA-acyl carrier protein transacylase-like protein PGA1:3.524..3.525 Mbp (1.035 kbp) score=20
secB protein-export protein SecB PGA1:3.69..3.691 Mbp (495 bp) score=20
PGA1_c35560 chemotaxis protein MotB-like protein PGA1:3.728..3.729 Mbp (837 bp) score=20
lptA OstA-like protein similar to lipopolysaccharide export system protein LptA PGA1:3.768..3.768 Mbp (480 bp) score=20
PGA1_c36190 activator of Hsp90 ATPase 1 family protein PGA1:3.788..3.788 Mbp (429 bp) score=20
PGA1_262p00020 plamid partition protein-like protein PGA1:3.967..3.968 Mbp (1.143 kbp) score=20
PGA1_262p00690 stressosome protein rsbRA-like protein PGA1:4.045..4.046 Mbp (876 bp) score=20
PGA1_262p00700 stressosome protein rsbS-like protein PGA1:4.046..4.046 Mbp (363 bp) score=20
PGA1_262p00710 serine/threonine-protein kinase RsbT-like protein PGA1:4.046..4.047 Mbp (408 bp) score=20
PGA1_262p00720 serine/threonine-protein kinase RsbT-like protein PGA1:4.047..4.048 Mbp (1.014 kbp) score=20
dppA periplasmic dipeptide transport protein precursor (dipeptide-binding protein) (DBP) PGA1:4.079..4.081 Mbp (1.557 kbp) score=20
PGA1_262p01760 epoxide hydrolase, eukaryotic-like protein similar to eukaryotic protein PGA1:4.159..4.16 Mbp (1.173 kbp) score=20
PGA1_262p02230 zinc uptake regulation protein zur-like protein PGA1:4.206..4.207 Mbp (483 bp) score=20
dnaA chromosomal replication initiator protein DnaA PGA1:101 bp..1.528 kbp (1.428 kbp) score=10
recF DNA replication and repair protein RecF PGA1:3.057..4.154 kbp (1.098 kbp) score=10
PGA1_c00050 TetR family transcriptional regulator PGA1:4.786..5.385 kbp (600 bp) score=10
PGA1_c00080 hypothetical protein PGA1:8.984..9.811 kbp (828 bp) score=10
PGA1_c00090 hypothetical protein PGA1:9.965..11.04 kbp (1.08 kbp) score=10
PGA1_c00100 hypothetical protein PGA1:11.06..12.08 kbp (1.026 kbp) score=10
PGA1_c00170 hypothetical protein PGA1:18.91..19.21 kbp (306 bp) score=10
PGA1_c00180 lysE type translocator-like protein PGA1:19.26..19.9 kbp (645 bp) score=10
PGA1_c00190 lysE type translocator-like protein PGA1:19.92..20.57 kbp (642 bp) score=10
PGA1_c00210 hypothetical protein PGA1:22.28..23.16 kbp (879 bp) score=10
PGA1_c00220 hypothetical protein PGA1:23.16..24.05 kbp (891 bp) score=10
PGA1_c00230 hypothetical protein PGA1:24.35..25.5 kbp (1.149 kbp) score=10
PGA1_c00240 hypothetical protein PGA1:25.67..25.89 kbp (222 bp) score=10
PGA1_c00250 hypothetical protein PGA1:26.38..27.09 kbp (705 bp) score=10
PGA1_c00340 hypothetical protein PGA1:38.72..39.27 kbp (555 bp) score=10
PGA1_c00350 hypothetical protein PGA1:39.43..40.98 kbp (1.551 kbp) score=10
PGA1_c00370 nnrU protein PGA1:42.54..43.23 kbp (696 bp) score=10
PGA1_c00390 glyoxalase-like protein PGA1:44.01..44.56 kbp (543 bp) score=10
PGA1_c00400 hypothetical protein PGA1:44.55..44.78 kbp (231 bp) score=10
PGA1_c00420 metallo-beta-lactamase-like protein PGA1:46.55..47.5 kbp (951 bp) score=10
PGA1_c00450 MarR family transcriptional regulator PGA1:50.31..50.75 kbp (441 bp) score=10
PGA1_c00460 adenylate cyclase domain-containing protein PGA1:50.81..52.02 kbp (1.215 kbp) score=10
PGA1_c00470 hypothetical protein PGA1:52.2..52.51 kbp (312 bp) score=10
PGA1_c00480 hypothetical protein PGA1:52.54..54.17 kbp (1.629 kbp) score=10
PGA1_c00490 hypothetical protein PGA1:54.16..54.97 kbp (810 bp) score=10
rpmE 50S ribosomal protein L31 PGA1:55.19..55.41 kbp (222 bp) score=10
rplS 50S ribosomal protein L19 PGA1:55.42..55.79 kbp (372 bp) score=10
PGA1_c00530 hypothetical protein PGA1:56.96..57.99 kbp (1.029 kbp) score=10
rimM 16S rRNA processing protein RimM PGA1:58..58.5 kbp (504 bp) score=10
rpsP 30S ribosomal protein S16 PGA1:59.3..59.66 kbp (360 bp) score=10
ffh signal recognition particle protein Ffh PGA1:61.99..63.52 kbp (1.524 kbp) score=10
PGA1_c00650 hypothetical protein PGA1:66.11..66.64 kbp (528 bp) score=10
PGA1_c00660 LysR family transcriptional regulator PGA1:66.75..67.62 kbp (879 bp) score=10
PGA1_c00670 hypothetical protein PGA1:67.62..68.53 kbp (909 bp) score=10
PGA1_c00680 ArsR family transcriptional regulator PGA1:68.54..68.88 kbp (348 bp) score=10
PGA1_c00690 hypothetical protein PGA1:68.98..69.87 kbp (894 bp) score=10
atpI ATP synthase protein I PGA1:70.08..70.41 kbp (336 bp) score=10
PGA1_c00750 UDP-N-acetylglucosamine acyltransferase-like protein PGA1:72.91..73.66 kbp (750 bp) score=10
PGA1_c00770 hypothetical protein PGA1:74.63..74.97 kbp (339 bp) score=10
sMC chromosome segregation protein SMC PGA1:75.09..78.55 kbp (3.456 kbp) score=10
PGA1_c00790 hypothetical protein PGA1:78.6..79.07 kbp (468 bp) score=10
PGA1_c00800 hypothetical protein PGA1:79.14..79.52 kbp (390 bp) score=10
cobD cobalamin biosynthesis protein CobD PGA1:80.78..81.69 kbp (912 bp) score=10
PGA1_c00840 glutathione transferase-like protein PGA1:83.06..84.04 kbp (975 bp) score=10
PGA1_c00850 hypothetical protein PGA1:84.36..84.73 kbp (363 bp) score=10
PGA1_c00910 hypothetical protein PGA1:88.74..88.97 kbp (237 bp) score=10
PGA1_c00920 hypothetical protein PGA1:88.99..89.61 kbp (624 bp) score=10
PGA1_c00950 hypothetical protein PGA1:90.67..91.12 kbp (453 bp) score=10
PGA1_c00960 lysE type translocator-like protein PGA1:91.12..91.73 kbp (618 bp) score=10
PGA1_c00980 hypothetical protein PGA1:93..93.57 kbp (570 bp) score=10
PGA1_c01020 hypothetical protein PGA1:96.93..97.58 kbp (654 bp) score=10
acpS holo-[acyl-carrier-protein] synthase AcpS PGA1:98.5..98.93 kbp (432 bp) score=10
era GTP-binding protein Era PGA1:100.5..101.4 kbp (906 bp) score=10
PGA1_c01080 hypothetical protein PGA1:101.4..101.8 kbp (330 bp) score=10
recO DNA repair protein RecO PGA1:101.8..102.5 kbp (726 bp) score=10
PGA1_c01100 hypothetical protein PGA1:102.5..102.9 kbp (405 bp) score=10
PGA1_c01120 sulfite exporter tauE/safE-like protein PGA1:104.8..105.6 kbp (789 bp) score=10
chvG sensor protein ChvG PGA1:109.3..111 kbp (1.713 kbp) score=10
PGA1_c01170 HPr kinase/phosphorylase-like protein PGA1:111.1..111.5 kbp (375 bp) score=10
PGA1_c01180 hypothetical protein PGA1:111.5..112.4 kbp (891 bp) score=10
PGA1_c01210 hypothetical protein PGA1:113.1..114 kbp (891 bp) score=10
PGA1_c01230 hypothetical protein PGA1:115.1..115.9 kbp (822 bp) score=10
etfA electron transfer flavoprotein subunit alpha PGA1:116..116.9 kbp (927 bp) score=10
etfB electron transfer flavoprotein subunit beta PGA1:116.9..117.7 kbp (759 bp) score=10
PGA1_c01270 hypothetical protein PGA1:118.6..118.8 kbp (207 bp) score=10
PGA1_c01290 hypothetical protein PGA1:119.7..120.4 kbp (702 bp) score=10
PGA1_c01310 hypothetical protein PGA1:123.2..123.8 kbp (612 bp) score=10
PGA1_c01330 hypothetical protein PGA1:125.7..126.4 kbp (747 bp) score=10
PGA1_c01360 preprotein translocase, secE subunit PGA1:129.3..129.5 kbp (198 bp) score=10
nusG transcription antitermination protein NusG PGA1:129.7..130.3 kbp (534 bp) score=10
rplK 50S ribosomal protein L11 PGA1:130.9..131.3 kbp (426 bp) score=10
rplA 50S ribosomal protein L1 PGA1:131.3..132 kbp (699 bp) score=10
rplJ 50S ribosomal protein L10 PGA1:132.4..133 kbp (576 bp) score=10
rplL 50S ribosomal protein L7/L12 PGA1:133.1..133.5 kbp (375 bp) score=10
PGA1_c01460 hypothetical protein PGA1:142.7..143.6 kbp (825 bp) score=10
PGA1_c01470 hypothetical protein PGA1:143.6..144.5 kbp (903 bp) score=10
PGA1_c01480 hypothetical protein PGA1:144.5..145.2 kbp (777 bp) score=10
rpsL 30S ribosomal protein S12 PGA1:145.7..146 kbp (372 bp) score=10
rpsG 30S ribosomal protein S7 PGA1:146..146.5 kbp (471 bp) score=10
PGA1_c01530 hypothetical protein PGA1:150.2..151.4 kbp (1.176 kbp) score=10
rpsJ 30S ribosomal protein S10 PGA1:151.6..151.9 kbp (321 bp) score=10
rplC 50S ribosomal protein L3 PGA1:152..152.7 kbp (714 bp) score=10
rplD 50S ribosomal protein L4 PGA1:152.7..153.3 kbp (618 bp) score=10
rplW 50S ribosomal protein L23 PGA1:153.3..153.6 kbp (297 bp) score=10
PGA1_c01580 hypothetical protein PGA1:153.8..154.6 kbp (858 bp) score=10
rplB 50S ribosomal protein L2 PGA1:154.9..155.7 kbp (843 bp) score=10
rpsS 30S ribosomal protein S19 PGA1:155.7..156 kbp (279 bp) score=10
rplV 50S ribosomal protein L22 PGA1:156..156.4 kbp (381 bp) score=10
rpsC 30S ribosomal protein S3 PGA1:156.4..157.1 kbp (708 bp) score=10
rplP 50S ribosomal protein L16 PGA1:157.1..157.5 kbp (414 bp) score=10
PGA1_c01640 hypothetical protein PGA1:157.6..158.1 kbp (468 bp) score=10
PGA1_c01650 hypothetical protein PGA1:158.2..158.8 kbp (621 bp) score=10
PGA1_c01660 hypothetical protein PGA1:158.9..159.2 kbp (345 bp) score=10
PGA1_c01670 hypothetical protein PGA1:159.3..159.7 kbp (375 bp) score=10
rpmC 50S ribosomal protein L29 PGA1:159.9..160.1 kbp (201 bp) score=10
rpsQ 30S ribosomal protein S17 PGA1:160.1..160.3 kbp (231 bp) score=10
rplN 50S ribosomal protein L14 PGA1:160.4..160.8 kbp (369 bp) score=10
rplX 50S ribosomal protein L24 PGA1:160.8..161.1 kbp (312 bp) score=10
rplE 50S ribosomal protein L5 PGA1:161.1..161.7 kbp (564 bp) score=10
rpsN 30S ribosomal protein S14 PGA1:161.7..162 kbp (306 bp) score=10
rpsH 30S ribosomal protein S8 PGA1:162..162.4 kbp (393 bp) score=10
rplF 50S ribosomal protein L6 PGA1:162.4..163 kbp (534 bp) score=10
rplR 50S ribosomal protein L18 PGA1:163..163.3 kbp (360 bp) score=10
rpsE 30S ribosomal protein S5 PGA1:163.5..164.1 kbp (567 bp) score=10
rpmD 50S ribosomal protein L30 PGA1:164.1..164.3 kbp (189 bp) score=10
PGA1_c01790 hypothetical protein PGA1:164.3..164.5 kbp (195 bp) score=10
PGA1_c01800 hypothetical protein PGA1:164.5..164.7 kbp (219 bp) score=10
PGA1_c01810 GntR family transcriptional regulator PGA1:164.9..166.3 kbp (1.413 kbp) score=10
PGA1_c01820 hypothetical protein PGA1:166.4..167.3 kbp (945 bp) score=10
PGA1_c01830 hypothetical protein PGA1:167.5..167.7 kbp (216 bp) score=10
PGA1_c01840 transmembrane ion channel-domain containing protein PGA1:168.3..168.8 kbp (513 bp) score=10
rplO 50S ribosomal protein L15 PGA1:169.1..169.6 kbp (471 bp) score=10
secY preprotein translocase SecY PGA1:169.7..171 kbp (1.365 kbp) score=10
rpsM 30S ribosomal protein S13 PGA1:172..172.4 kbp (369 bp) score=10
rpsK 30S ribosomal protein S11 PGA1:172.4..172.8 kbp (390 bp) score=10
rplQ 50S ribosomal protein L17 PGA1:174.1..174.5 kbp (423 bp) score=10
rarA replication-associated recombination protein A PGA1:176.1..177.4 kbp (1.323 kbp) score=10
PGA1_c01940 crcB-like protein PGA1:177.5..177.9 kbp (381 bp) score=10
PGA1_c01970 hypothetical protein PGA1:179.7..180.4 kbp (708 bp) score=10
bztA glutamate/glutamine/aspartate/asparagine-binding protein BztA PGA1:180.6..181.6 kbp (1.017 kbp) score=10
bztD glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD PGA1:184.3..185.1 kbp (792 bp) score=10
PGA1_c02020 hypothetical protein PGA1:185.2..185.7 kbp (459 bp) score=10
PGA1_c02040 hypothetical protein PGA1:186.4..187.1 kbp (744 bp) score=10
engB GTP binding protein EngB PGA1:189.3..189.9 kbp (651 bp) score=10
PGA1_c02080 hypothetical protein PGA1:189.9..190.7 kbp (753 bp) score=10
oxaA inner membrane protein OxaA PGA1:190.7..192.5 kbp (1.818 kbp) score=10
ttcA tRNA 2-thiocytidine biosynthesis protein TtcA PGA1:194.5..195.4 kbp (888 bp) score=10
PGA1_c02120 hypothetical protein PGA1:195.6..196.1 kbp (573 bp) score=10
PGA1_c02130 hypothetical protein PGA1:196.1..196.4 kbp (273 bp) score=10
rpmH 50S ribosomal protein L34 PGA1:197..197.1 kbp (135 bp) score=10
PGA1_c02170 hypothetical protein PGA1:197.5..198.3 kbp (804 bp) score=10
PGA1_c02230 hypothetical protein PGA1:202.5..202.7 kbp (180 bp) score=10
PGA1_c02280 hypothetical protein PGA1:204.7..205.7 kbp (951 bp) score=10
PGA1_c02330 hypothetical protein PGA1:209.7..210.2 kbp (507 bp) score=10
yfdC inner membrane protein YfdC PGA1:211.4..212.2 kbp (840 bp) score=10
PGA1_c02380 hypothetical protein PGA1:215.2..216.5 kbp (1.272 kbp) score=10
PGA1_c02390 MerR family transcriptional regulator PGA1:216.5..216.9 kbp (405 bp) score=10
PGA1_c02420 hypothetical protein PGA1:218.7..219.4 kbp (714 bp) score=10
PGA1_c02430 HlyD family type I secretion membrane fusion protein PGA1:219.7..220.8 kbp (1.17 kbp) score=10
PGA1_c02450 outer membrane efflux protein PGA1:223.2..224.5 kbp (1.32 kbp) score=10
PGA1_c02460 hypothetical protein PGA1:224.6..228.3 kbp (3.678 kbp) score=10
PGA1_c02470 serine-protein kinase, PrkA type PGA1:229..230.9 kbp (1.935 kbp) score=10
PGA1_c02480 hypothetical protein PGA1:230.9..232.3 kbp (1.338 kbp) score=10
PGA1_c02500 GntR family transcriptional regulator PGA1:233.8..234.5 kbp (666 bp) score=10
hmrR HTH-type transcriptional regulator PGA1:238.6..239 kbp (405 bp) score=10
PGA1_c02540 hypothetical protein PGA1:239.3..240.1 kbp (837 bp) score=10
PGA1_c02580 HTH-type transcriptional regulator pcaQ PGA1:242..242.9 kbp (918 bp) score=10
livH high-affinity branched-chain amino acid transport system permease protein LivH PGA1:243.2..244 kbp (876 bp) score=10
livM high-affinity branched-chain amino acid transport system permease protein LivM PGA1:244..245.1 kbp (1.086 kbp) score=10
livG high-affinity branched-chain amino acid transport ATP-binding protein LivG PGA1:245.1..245.9 kbp (768 bp) score=10
livF high-affinity branched-chain amino acid transport ATP-binding protein LivF PGA1:245.9..246.7 kbp (774 bp) score=10
PGA1_c02640 amino acid binding protein PGA1:248.7..249.8 kbp (1.161 kbp) score=10
PGA1_c02650 hypothetical protein PGA1:250..250.9 kbp (918 bp) score=10
PGA1_c02660 hypothetical protein PGA1:251.3..253 kbp (1.665 kbp) score=10
PGA1_c02670 quinone oxidoreductase-like protein PGA1:253.1..254.1 kbp (990 bp) score=10
PGA1_c02690 hypothetical protein PGA1:254.8..257.7 kbp (2.91 kbp) score=10
PGA1_c02700 HTH-type transcriptional regulator PGA1:257.9..258.9 kbp (1.014 kbp) score=10
PGA1_c02710 sn-glycerol-3-phosphate-binding periplasmic protein ugpB PGA1:259.1..260.4 kbp (1.302 kbp) score=10
ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgbC PGA1:262.3..263.3 kbp (1.047 kbp) score=10
PGA1_c02750 hypothetical protein PGA1:263.3..264.3 kbp (1.002 kbp) score=10
PGA1_c02760 methylated-DNA--protein-cysteine methyltransferase PGA1:264.4..265.5 kbp (1.071 kbp) score=10
PGA1_c02780 hypothetical protein PGA1:267.2..268.3 kbp (1.185 kbp) score=10
PGA1_c02800 AraC family transcriptional regulator PGA1:269.8..270.6 kbp (873 bp) score=10
PGA1_c02820 AraC family transcriptional regulator PGA1:271.9..272.6 kbp (657 bp) score=10
PGA1_c02830 ABC transporter ATP-binding protein PGA1:272.8..273.7 kbp (930 bp) score=10
PGA1_c02850 peptidase S49-like protein PGA1:274.7..275.5 kbp (798 bp) score=10
PGA1_c02860 sodium/calcium exchanger protein PGA1:275.7..276.6 kbp (945 bp) score=10
uvrC uvrABC system protein C PGA1:277.7..279.6 kbp (1.89 kbp) score=10
PGA1_c02920 hypothetical protein PGA1:281.2..281.5 kbp (315 bp) score=10
PGA1_c02930 OmpA domain-containing protein PGA1:281.5..283.4 kbp (1.911 kbp) score=10
PGA1_c02950 RNA methyltransferase-like protein PGA1:284.5..285.2 kbp (729 bp) score=10
PGA1_c02960 hypothetical protein PGA1:285.2..286.1 kbp (909 bp) score=10
PGA1_c02970 hypothetical protein PGA1:286.1..286.6 kbp (528 bp) score=10
PGA1_c02990 hypothetical protein PGA1:288.3..288.6 kbp (255 bp) score=10
PGA1_c03000 hypothetical protein PGA1:288.7..289.1 kbp (474 bp) score=10
PGA1_c03030 hypothetical protein PGA1:291.3..291.9 kbp (534 bp) score=10
PGA1_c03040 hypothetical protein PGA1:291.9..292.2 kbp (384 bp) score=10
PGA1_c03050 hypothetical protein PGA1:292.2..292.8 kbp (558 bp) score=10
moaB molybdenum cofactor biosynthesis protein B PGA1:294.7..295.3 kbp (543 bp) score=10
PGA1_c03090 secretion protein PGA1:295.4..296.9 kbp (1.491 kbp) score=10
PGA1_c03120 hypothetical protein PGA1:300.9..301.7 kbp (855 bp) score=10
PGA1_c03130 hypothetical protein PGA1:301.9..302.5 kbp (558 bp) score=10
PGA1_c03140 tRNA threonylcarbamoyladenosine biosynthesis protein PGA1:302.5..303.5 kbp (948 bp) score=10
PGA1_c03160 metallo-beta-lactamase-like protein PGA1:305.3..306.3 kbp (1.038 kbp) score=10
PGA1_c03170 hypothetical protein PGA1:306.4..306.8 kbp (465 bp) score=10
PGA1_c03180 hypothetical protein PGA1:306.9..307.4 kbp (486 bp) score=10
PGA1_c03190 hypothetical protein PGA1:307.5..307.6 kbp (135 bp) score=10
PGA1_c03200 hypothetical protein PGA1:307.6..308.3 kbp (669 bp) score=10
mobA molybdopterin-guanine dinucleotide biosynthesis protein A PGA1:310.5..311.1 kbp (642 bp) score=10
mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB PGA1:311.1..311.6 kbp (492 bp) score=10
PGA1_c03260 hypothetical protein PGA1:311.6..312.4 kbp (813 bp) score=10
PGA1_c03280 hypothetical protein PGA1:313.7..314.7 kbp (1.014 kbp) score=10
PGA1_c03320 electron transfer flavoprotein-ubiquinone oxidoreductase PGA1:317..318.6 kbp (1.65 kbp) score=10
PGA1_c03330 hypothetical protein PGA1:318.8..320.5 kbp (1.749 kbp) score=10
PGA1_c03360 hypothetical protein PGA1:322.7..323.5 kbp (768 bp) score=10
PGA1_c03365 hypothetical protein PGA1:323.6..323.8 kbp (180 bp) score=10
PGA1_c03370 hypothetical protein PGA1:324..324.2 kbp (207 bp) score=10
PGA1_c03410 EAL domain-containing protein PGA1:328..328.8 kbp (843 bp) score=10
PGA1_c03430 hypothetical protein PGA1:329.8..330.3 kbp (441 bp) score=10
PGA1_c03460 hypothetical protein PGA1:332.5..332.6 kbp (186 bp) score=10
PGA1_c03480 hypothetical protein PGA1:334..336.8 kbp (2.814 kbp) score=10
PGA1_c03490 hypothetical protein PGA1:336.9..337.8 kbp (882 bp) score=10
ftsE cell division ATP-binding protein FtsE PGA1:338..338.7 kbp (678 bp) score=10
PGA1_c03530 pyridoxamine 5'-phosphate oxidase-like protein PGA1:340.3..340.9 kbp (606 bp) score=10
PGA1_c03540 hypothetical protein PGA1:341..341.3 kbp (315 bp) score=10
PGA1_c03560 hypothetical protein PGA1:342.9..343.3 kbp (390 bp) score=10
PGA1_c03570 hypothetical protein PGA1:343.4..343.5 kbp (159 bp) score=10
PGA1_c03580 hypothetical protein PGA1:343.6..343.8 kbp (261 bp) score=10
PGA1_c03620 hypothetical protein PGA1:349.9..350.2 kbp (354 bp) score=10
PGA1_c03640 hypothetical protein PGA1:351.8..352.3 kbp (549 bp) score=10
PGA1_c03660 hypothetical protein PGA1:353.6..354.3 kbp (756 bp) score=10
PGA1_c03670 hypothetical protein PGA1:354.4..354.7 kbp (330 bp) score=10
PGA1_c03690 nnrU protein PGA1:356..356.6 kbp (549 bp) score=10
PGA1_c03700 hypothetical protein PGA1:356.6..356.8 kbp (204 bp) score=10
PGA1_c03710 hypothetical protein PGA1:356.8..357.8 kbp (1.032 kbp) score=10
PGA1_c03730 hypothetical protein PGA1:358.5..359.2 kbp (690 bp) score=10
sdhA succinate dehydrogenase flavoprotein subunit PGA1:360.2..362 kbp (1.806 kbp) score=10
PGA1_c03770 hypothetical protein PGA1:362.1..363 kbp (915 bp) score=10
PGA1_c03790 hypothetical protein PGA1:364.1..364.3 kbp (192 bp) score=10
PGA1_c03810 hypothetical protein PGA1:366.1..367 kbp (876 bp) score=10
PGA1_c03830 regulatory protein, H-NS histone family PGA1:367.8..368.1 kbp (318 bp) score=10
PGA1_c03900 hypothetical protein PGA1:376.3..377.8 kbp (1.539 kbp) score=10
PGA1_c03920 hypothetical protein PGA1:378.6..379.5 kbp (891 bp) score=10
PGA1_c03930 hypothetical protein PGA1:379.5..380.5 kbp (924 bp) score=10
rbsA1 ribose import ATP-binding protein RbsA PGA1:382.8..384.3 kbp (1.53 kbp) score=10
PGA1_c03970 lipoprotein PGA1:384.5..385.5 kbp (996 bp) score=10
PGA1_c04010 universal stress protein PGA1:387.4..387.9 kbp (456 bp) score=10
paaD phenylacetic acid degradation protein PaaD PGA1:390.9..391.3 kbp (474 bp) score=10
paaC phenylacetic acid degradation protein PaaC PGA1:391.4..392.2 kbp (774 bp) score=10
paaB phenylacetic acid degradation protein PaaB PGA1:392.2..392.5 kbp (285 bp) score=10
paaA phenylacetic acid degradation protein PaaA PGA1:392.6..393.6 kbp (978 bp) score=10
PGA1_c04150 thioesterase domain-containing protein PGA1:402.7..403.2 kbp (465 bp) score=10
phnC phosphonates import ATP-binding protein PhnC PGA1:405.7..406.5 kbp (819 bp) score=10
phoD phosphate uptake ABC transporter periplasmic solute-binding protein PhoD PGA1:406.6..407.5 kbp (909 bp) score=10
phoE phosphate uptake ABC transporter permease protein PhoE PGA1:407.6..408.5 kbp (870 bp) score=10
phoT phosphate uptake ABC transporter permease protein PhoT PGA1:408.5..409.9 kbp (1.371 kbp) score=10
PGA1_c04230 phosphonates metabolism transcriptional regulator phnF PGA1:410.6..411.3 kbp (735 bp) score=10
phnG protein PhnG PGA1:411.4..411.9 kbp (477 bp) score=10
phnH protein PhnH PGA1:411.9..412.5 kbp (597 bp) score=10
phnI protein PhnI PGA1:412.5..413.6 kbp (1.11 kbp) score=10
phnJ protein PhnJ PGA1:413.8..414.7 kbp (858 bp) score=10
phnK phosphonates transport ATP-binding protein PhnK PGA1:414.7..415.5 kbp (771 bp) score=10
phnL phosphonates transport ATP-binding protein PhnL PGA1:415.5..416.2 kbp (684 bp) score=10
phnN ATP-binding protein PhnN PGA1:416.2..416.7 kbp (546 bp) score=10
PGA1_c04310 hypothetical protein PGA1:416.7..417.4 kbp (684 bp) score=10
phnM protein PhnM PGA1:417.4..418.6 kbp (1.143 kbp) score=10
PGA1_c04330 hypothetical protein PGA1:418.7..419.1 kbp (480 bp) score=10
PGA1_c04340 hypothetical protein PGA1:419.1..419.9 kbp (759 bp) score=10
PGA1_c04350 glycosyltransferase protein PGA1:419.9..421 kbp (1.143 kbp) score=10
PGA1_c04360 phosphoglycerate mutase family protein PGA1:421..421.6 kbp (591 bp) score=10
PGA1_c04370 glycosyltransferase protein PGA1:421.6..422.7 kbp (1.035 kbp) score=10
PGA1_c04390 hypothetical protein PGA1:424..425.2 kbp (1.212 kbp) score=10
PGA1_c04400 mechanosensitive ion channel-like protein PGA1:425.6..428 kbp (2.37 kbp) score=10
PGA1_c04410 hypothetical protein PGA1:428..429.4 kbp (1.377 kbp) score=10
gsiD1 glutathione transport system permease protein GsiD PGA1:429.4..430.6 kbp (1.155 kbp) score=10
PGA1_c04430 peptide permease protein PGA1:430.6..431.6 kbp (1.029 kbp) score=10
PGA1_c04440 extracellular solute-binding protein PGA1:431.6..433.5 kbp (1.944 kbp) score=10
gsiA1 glutathione import ATP-binding protein GsiA PGA1:433.5..435.3 kbp (1.779 kbp) score=10
PGA1_c04460 hypothetical protein PGA1:435.6..436.1 kbp (510 bp) score=10
PGA1_c04480 TetR family transcriptional regulator PGA1:437..437.6 kbp (666 bp) score=10
PGA1_c04500 AsnC family transcriptional regulator PGA1:441.2..441.7 kbp (516 bp) score=10
PGA1_c04510 hypothetical protein PGA1:441.7..442.1 kbp (393 bp) score=10
PGA1_c04520 ABC transporter cyclic nucleotide-binding protein PGA1:442.4..445.4 kbp (2.958 kbp) score=10
PGA1_c04580 endonuclease/exonuclease/phosphatase domain-containing protein PGA1:451.3..452.5 kbp (1.203 kbp) score=10
PGA1_c04600 hypothetical protein PGA1:453.6..454.2 kbp (690 bp) score=10
fabI1 enoyl-[acyl-carrier-protein] reductase FabI PGA1:457..457.7 kbp (792 bp) score=10
fabA 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase FabA PGA1:459..459.5 kbp (510 bp) score=10
PGA1_c04680 LysR family transcriptional regulator PGA1:460.2..461.1 kbp (909 bp) score=10
PGA1_c04700 hypothetical protein PGA1:462.1..463 kbp (945 bp) score=10
PGA1_c04730 hypothetical protein PGA1:465.2..465.5 kbp (303 bp) score=10
PGA1_c04740 phoH-like protein PGA1:465.6..466.6 kbp (1.008 kbp) score=10
PGA1_c04750 hypothetical protein PGA1:466.8..467.3 kbp (531 bp) score=10
int apolipoprotein N-acyltransferase Int PGA1:468.2..469.7 kbp (1.512 kbp) score=10
PGA1_c04790 hypothetical protein PGA1:471.2..471.9 kbp (711 bp) score=10
rpsA 30S ribosomal protein S1 PGA1:475.1..476.8 kbp (1.68 kbp) score=10
PGA1_c04850 hypothetical protein PGA1:477.5..477.8 kbp (351 bp) score=10
PGA1_c04880 hypothetical protein PGA1:479.9..480.3 kbp (384 bp) score=10
rplY 50S ribosomal protein L25 PGA1:482.5..483.1 kbp (630 bp) score=10
PGA1_c04940 hypothetical protein PGA1:485.5..486 kbp (513 bp) score=10
engD GTP-dependent nucleic acid-binding protein EngD PGA1:486.3..487.4 kbp (1.098 kbp) score=10
PGA1_c04970 hypothetical protein PGA1:488.5..488.8 kbp (300 bp) score=10
PGA1_c05000 hypothetical protein PGA1:491.8..494.6 kbp (2.823 kbp) score=10
PGA1_c05080 hypothetical protein PGA1:500.9..501.3 kbp (435 bp) score=10
PGA1_c05100 GntR family transcriptional regulator PGA1:502.7..503.4 kbp (663 bp) score=10
PGA1_c05110 dihydrodipicolinate synthase domain-containing protein PGA1:503.6..504.5 kbp (960 bp) score=10
PGA1_c05160 peptidase M56-like protein PGA1:510.8..511.9 kbp (1.152 kbp) score=10
PGA1_c05170 penicillinase repressor blaI/mecI-like protein PGA1:511.9..512.3 kbp (396 bp) score=10
PGA1_c05180 hypothetical protein PGA1:512.5..512.8 kbp (279 bp) score=10
ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgbC PGA1:514.4..515.5 kbp (1.116 kbp) score=10
ugpC3 sn-glycerol-3-phosphate import ATP-binding protein UgpC PGA1:515.6..516.7 kbp (1.119 kbp) score=10
PGA1_c05230 ABC transporter, extracellular solute-binding protein PGA1:516.8..518.5 kbp (1.734 kbp) score=10
PGA1_c05240 hypothetical protein PGA1:518.8..520 kbp (1.131 kbp) score=10
PGA1_c05250 hypothetical protein PGA1:520..521 kbp (990 bp) score=10
PGA1_c05270 hypothetical protein PGA1:522.5..523.6 kbp (1.074 kbp) score=10
PGA1_c05280 hypothetical protein PGA1:523.7..525 kbp (1.287 kbp) score=10
PGA1_c05320 hypothetical protein PGA1:528.6..531.1 kbp (2.571 kbp) score=10
PGA1_c05330 hypothetical protein PGA1:531.1..532 kbp (903 bp) score=10
PGA1_c05340 4'-phosphopantetheinyl transferase-like protein PGA1:532..532.8 kbp (714 bp) score=10
PGA1_c05380 hypothetical protein PGA1:545.2..546.7 kbp (1.464 kbp) score=10
PGA1_c05390 glycosyl transferase family protein PGA1:546.8..547.6 kbp (753 bp) score=10
PGA1_c05410 hypothetical protein PGA1:548.6..549.7 kbp (1.11 kbp) score=10
PGA1_c05430 hypothetical protein PGA1:550.8..554.5 kbp (3.666 kbp) score=10
PGA1_c05440 surface antigen-like protein PGA1:554.5..556.4 kbp (1.944 kbp) score=10
PGA1_c05450 hypothetical protein PGA1:556.6..557.8 kbp (1.233 kbp) score=10
PGA1_c05460 LysR family transcriptional regulator PGA1:558..559 kbp (975 bp) score=10
PGA1_c05480 OHCU decarboxylase domain-containing protein PGA1:559.6..561 kbp (1.416 kbp) score=10
PGA1_c05520 hypothetical protein PGA1:564.3..564.8 kbp (501 bp) score=10
PGA1_c05530 hypothetical protein PGA1:564.9..565.9 kbp (993 bp) score=10
PGA1_c05540 IclR family transcriptional regulator PGA1:566..566.8 kbp (819 bp) score=10
PGA1_c05550 glutamine synthase-like protein PGA1:567.1..568.6 kbp (1.452 kbp) score=10
gcvH glycine cleavage system protein GcvH PGA1:569.2..569.6 kbp (363 bp) score=10
gcvH glycine cleavage system protein GcvH PGA1:569.2..569.6 kbp (363 bp) score=10
PGA1_c05570 glycine dehydrogenase [decarboxylating]-like protein PGA1:569.7..572.6 kbp (2.849 kbp) score=10
PGA1_c05590 acyl-CoA dehydrogenase-like protein PGA1:572.7..573.9 kbp (1.239 kbp) score=10
queC queuosine biosynthesis protein QueC PGA1:574.2..574.9 kbp (699 bp) score=10
queD queuosine biosynthesis protein QueD PGA1:574.9..575.2 kbp (354 bp) score=10
queE 7-cyano-7-deazaguanosine biosynthesis protein QueE PGA1:575.2..576 kbp (798 bp) score=10
PGA1_c05640 hypothetical protein PGA1:576.6..577.2 kbp (672 bp) score=10
PGA1_c05660 hypothetical protein PGA1:578.3..579.7 kbp (1.416 kbp) score=10
PGA1_c05670 acetyltransferase domain-containing protein PGA1:579.7..580.3 kbp (555 bp) score=10
PGA1_c05680 hypothetical protein PGA1:580.3..581.3 kbp (1.056 kbp) score=10
PGA1_c05690 hypothetical protein PGA1:581.4..581.9 kbp (411 bp) score=10
PGA1_c05700 hypothetical protein PGA1:582..583.8 kbp (1.845 kbp) score=10
PGA1_c05720 hypothetical protein PGA1:587.1..587.5 kbp (345 bp) score=10
PGA1_c05730 methylated-DNA--protein-cysteine methyltransferase PGA1:587.7..588.2 kbp (489 bp) score=10
PGA1_c05750 hypothetical protein PGA1:589.3..589.6 kbp (342 bp) score=10
PGA1_c05770 hypothetical protein PGA1:590.6..591.4 kbp (708 bp) score=10
priA primosomal protein N PGA1:592.3..594.5 kbp (2.196 kbp) score=10
PGA1_c05800 hypothetical protein PGA1:594.7..595.7 kbp (1.065 kbp) score=10
PGA1_c05810 transporter protein, MFS family PGA1:595.9..597.1 kbp (1.236 kbp) score=10
prmA ribosomal protein L11 methyltransferase PrmA PGA1:597.2..598.1 kbp (873 bp) score=10
PGA1_c05830 hypothetical protein PGA1:598.2..598.5 kbp (345 bp) score=10
PGA1_c05840 hypothetical protein PGA1:598.7..598.9 kbp (219 bp) score=10
PGA1_c05880 hypothetical protein PGA1:602..602.6 kbp (669 bp) score=10
PGA1_c05890 thioesterase domain-containing protein PGA1:602.6..603 kbp (387 bp) score=10
tolQ protein TolQ PGA1:603.1..603.8 kbp (696 bp) score=10
exbD biopolymer transport protein ExbD PGA1:603.8..604.3 kbp (489 bp) score=10
PGA1_c05920 hypothetical protein PGA1:604.3..605.5 kbp (1.14 kbp) score=10
tolB protein TolB PGA1:605.5..606.8 kbp (1.314 kbp) score=10
PGA1_c05940 peptidoglycan-associated lipoprotein PGA1:606.9..607.5 kbp (510 bp) score=10
PGA1_c05950 hypothetical protein PGA1:607.5..608.3 kbp (843 bp) score=10
PGA1_c05980 hypothetical protein PGA1:611.7..612.3 kbp (579 bp) score=10
PGA1_c06000 chorismate mutase-like protein PGA1:614.3..614.6 kbp (306 bp) score=10
PGA1_c06020 thioesterase domain-containing protein PGA1:615.6..616 kbp (411 bp) score=10
PGA1_c06030 hypothetical protein PGA1:616.1..616.8 kbp (675 bp) score=10
PGA1_c06050 hypothetical protein PGA1:619.4..620.7 kbp (1.308 kbp) score=10
PGA1_c06060 hypothetical protein PGA1:620.8..621.4 kbp (507 bp) score=10
PGA1_c06070 hypothetical protein PGA1:621.4..622.2 kbp (849 bp) score=10
PGA1_c06080 hypothetical protein PGA1:622.3..622.9 kbp (603 bp) score=10
PGA1_c06110 hypothetical protein PGA1:624.8..626.3 kbp (1.446 kbp) score=10
PGA1_c06120 hypothetical protein PGA1:626.3..627.5 kbp (1.233 kbp) score=10
PGA1_c06140 bacterial type II/III secretion system protein PGA1:628.4..629.8 kbp (1.455 kbp) score=10
PGA1_c06160 hypothetical protein PGA1:631..631.2 kbp (177 bp) score=10
PGA1_c06170 hypothetical protein PGA1:631.3..631.5 kbp (186 bp) score=10
PGA1_c06180 hypothetical protein PGA1:631.8..632.8 kbp (930 bp) score=10
PGA1_c06190 hypothetical protein PGA1:632.9..633.4 kbp (492 bp) score=10
smf protein Smf PGA1:637.9..639.1 kbp (1.239 kbp) score=10
tldD protein TldD PGA1:639.4..640.9 kbp (1.422 kbp) score=10
PGA1_c06270 hypothetical protein PGA1:643..643.2 kbp (180 bp) score=10
ctaG cytochrome c oxidase assembly protein CtaG PGA1:643.2..643.7 kbp (588 bp) score=10
PGA1_c06300 hypothetical protein PGA1:644.7..645.4 kbp (675 bp) score=10
PGA1_c06330 ribosomal-protein-alanine acetyltransferase PGA1:648..648.6 kbp (591 bp) score=10
PGA1_c06360 hypothetical protein PGA1:651.6..652.1 kbp (477 bp) score=10
PGA1_c06410 hypothetical protein PGA1:656.6..657.2 kbp (606 bp) score=10
PGA1_c06420 acetyltransferase domain-containing protein PGA1:657.4..657.9 kbp (510 bp) score=10
PGA1_c06430 hypothetical protein PGA1:658..658.8 kbp (780 bp) score=10
PGA1_c06440 hypothetical protein PGA1:658.9..659.5 kbp (531 bp) score=10
PGA1_c06450 short-chain dehydrogenases/reductase domain-containing protein PGA1:659.5..660.1 kbp (642 bp) score=10
PGA1_c06460 hypothetical protein PGA1:660.2..662 kbp (1.779 kbp) score=10
PGA1_c06480 hypothetical protein PGA1:663.2..663.8 kbp (534 bp) score=10
PGA1_c06520 cell wall hydrolase-like protein PGA1:670.3..671 kbp (684 bp) score=10
PGA1_c06530 dihydroneopterin aldolase-like protein PGA1:671.1..672 kbp (921 bp) score=10
PGA1_c06560 hypothetical protein PGA1:674.5..675.4 kbp (909 bp) score=10
PGA1_c06570 hypothetical protein PGA1:675.5..676.4 kbp (915 bp) score=10
PGA1_c06590 AsnC family transcriptional regulator PGA1:677.6..678.1 kbp (456 bp) score=10
PGA1_c06600 AsnC family transcriptional regulator PGA1:678.1..678.5 kbp (459 bp) score=10
PGA1_c06610 hypothetical protein PGA1:678.5..679.2 kbp (693 bp) score=10
PGA1_c06630 hypothetical protein PGA1:680.5..680.8 kbp (246 bp) score=10
PGA1_c06650 GntR family transcriptional regulator PGA1:681.8..682.4 kbp (654 bp) score=10
PGA1_c06660 glycosyl transferase-like protein PGA1:682.4..684.4 kbp (1.941 kbp) score=10
PGA1_c06680 hypothetical protein PGA1:685.9..686.4 kbp (474 bp) score=10
PGA1_c06690 prephenate dehydrogenase-like protein PGA1:686.4..687.2 kbp (786 bp) score=10
PGA1_c06700 hypothetical protein PGA1:687.4..687.9 kbp (486 bp) score=10
PGA1_c06720 hypothetical protein PGA1:690.1..690.5 kbp (426 bp) score=10
PGA1_c06730 hypothetical protein PGA1:690.9..692.8 kbp (1.923 kbp) score=10
PGA1_c06750 hypothetical protein PGA1:693.6..695.3 kbp (1.662 kbp) score=10
PGA1_c06770 hypothetical protein PGA1:695.8..696 kbp (240 bp) score=10
PGA1_c06780 extracellular solute-binding protein PGA1:697.5..699 kbp (1.581 kbp) score=10
dppD1 dipeptide transport ATP-binding protein DppD PGA1:701.1..702 kbp (981 bp) score=10
dppF dipeptide transport ATP-binding protein DppF PGA1:702..703 kbp (966 bp) score=10
dppF dipeptide transport ATP-binding protein DppF PGA1:702..703 kbp (966 bp) score=10
PGA1_c06830 hypothetical protein PGA1:703..703.9 kbp (897 bp) score=10
PGA1_c06870 hypothetical protein PGA1:705.6..706.4 kbp (822 bp) score=10
PGA1_c06880 hypothetical protein PGA1:706.5..708.4 kbp (1.848 kbp) score=10
PGA1_c06910 hypothetical protein PGA1:711.4..711.8 kbp (396 bp) score=10
PGA1_c06920 hypothetical protein PGA1:711.8..712.4 kbp (537 bp) score=10
PGA1_c06930 hypothetical protein PGA1:712.4..712.8 kbp (399 bp) score=10
PGA1_c06950 hypothetical protein PGA1:715.7..716.2 kbp (432 bp) score=10
PGA1_c06960 hypothetical protein PGA1:716.3..716.6 kbp (318 bp) score=10
PGA1_c06980 hypothetical protein PGA1:718.3..718.5 kbp (222 bp) score=10
rpmI 50S ribosomal protein L35 PGA1:718.7..718.9 kbp (201 bp) score=10
rplT 50S ribosomal protein L20 PGA1:719..719.3 kbp (366 bp) score=10
PGA1_c07020 hypothetical protein PGA1:720.8..721.6 kbp (822 bp) score=10
PGA1_c07040 LysR family transcriptional regulator PGA1:724.1..725 kbp (879 bp) score=10
PGA1_c07050 methyltransferase domain-containing protein PGA1:725.1..725.7 kbp (636 bp) score=10
PGA1_c07060 hypothetical protein PGA1:725.9..726.3 kbp (450 bp) score=10
PGA1_c07070 acetyltransferase domain-containing protein PGA1:726.3..726.9 kbp (528 bp) score=10
PGA1_c07100 hypothetical protein PGA1:728.7..731.1 kbp (2.358 kbp) score=10
PGA1_c07120 universal stress protein PGA1:732.7..733.1 kbp (435 bp) score=10
PGA1_c07130 leucine-responsive regulatory protein PGA1:733.3..733.7 kbp (456 bp) score=10
mauG methylamine utilization protein MauG PGA1:733.7..735 kbp (1.254 kbp) score=10
PGA1_c07150 hypothetical protein PGA1:735..735.8 kbp (801 bp) score=10
PGA1_c07160 hypothetical protein PGA1:735.8..737.1 kbp (1.311 kbp) score=10
PGA1_c07170 acetate operon repressor-like protein PGA1:737.1..737.9 kbp (813 bp) score=10
PGA1_c07190 IclR family transcriptional regulator PGA1:739.3..740.3 kbp (1.074 kbp) score=10
PGA1_c07200 phytanoyl-CoA dioxygenase-like protein PGA1:740.4..741.6 kbp (1.185 kbp) score=10
PGA1_c07230 myo-inositol catabolism protein PGA1:743.4..744.3 kbp (858 bp) score=10
PGA1_c07270 iolE/mocC family protein PGA1:748.4..749.3 kbp (894 bp) score=10
PGA1_c07290 LacL family transcriptional regulator PGA1:750.5..751.5 kbp (1.002 kbp) score=10
PGA1_c07300 hypothetical protein PGA1:751.8..752.7 kbp (951 bp) score=10
PGA1_c07310 binding protein dependent transport system permease PGA1:752.8..753.9 kbp (1.122 kbp) score=10
PGA1_c07320 sugar ABC transporter ATP-binding protein PGA1:753.9..754.7 kbp (786 bp) score=10
PGA1_c07340 hypothetical protein PGA1:756.7..757.5 kbp (873 bp) score=10
PGA1_c07400 binding protein dependent transport system permease PGA1:763.7..764.5 kbp (849 bp) score=10
PGA1_c07410 binding protein dependent transport system permease PGA1:764.5..765.5 kbp (948 bp) score=10
PGA1_c07420 extracellular solute-binding protein PGA1:765.6..766.9 kbp (1.251 kbp) score=10
PGA1_c07430 IclR family transcriptional regulator PGA1:767..767.8 kbp (792 bp) score=10
PGA1_c07440 ABC transporter ATP-binding protein PGA1:767.8..768.9 kbp (1.062 kbp) score=10
PGA1_c07460 glutathione S-transferase domain-containing protein PGA1:769.6..770.2 kbp (615 bp) score=10
PGA1_c07465 dksA/traR C4-type zinc finger protein PGA1:770.5..770.8 kbp (270 bp) score=10
PGA1_c07480 hypothetical protein PGA1:772.8..773.8 kbp (963 bp) score=10
PGA1_c07490 hypothetical protein PGA1:773.8..774.1 kbp (288 bp) score=10
PGA1_c07500 hypothetical protein PGA1:774.2..774.8 kbp (570 bp) score=10
PGA1_c07510 DNA/RNA helicase-like protein PGA1:774.8..777.8 kbp (3.018 kbp) score=10
PGA1_c07520 heat shock protein PGA1:777.8..778.2 kbp (366 bp) score=10
PGA1_c07540 transcription factor carD-like protein PGA1:779..779.5 kbp (513 bp) score=10
PGA1_c07550 ion channel domain-containing protein PGA1:779.7..780.4 kbp (774 bp) score=10
kefC glutathione-regulated potassium-efflux system protein KefC PGA1:782.4..784.3 kbp (1.893 kbp) score=10
PGA1_c07590 aerotaxis receptor-like protein PGA1:784.8..786 kbp (1.221 kbp) score=10
PGA1_c07600 AsnC/LRP family transcriptional regulator PGA1:786.1..786.5 kbp (456 bp) score=10
PGA1_c07620 hypothetical protein PGA1:787.9..790.6 kbp (2.7 kbp) score=10
PGA1_c07630 hypothetical protein PGA1:790.8..791.5 kbp (717 bp) score=10
PGA1_c07650 hypothetical protein PGA1:793..794 kbp (990 bp) score=10
PGA1_c07680 hypothetical protein PGA1:796.8..797.4 kbp (609 bp) score=10
PGA1_c07720 universal stress protein PGA1:799.7..800.1 kbp (411 bp) score=10
PGA1_c07790 hypothetical protein PGA1:806.3..806.5 kbp (186 bp) score=10
PGA1_c07800 LacL family transcriptional regulator PGA1:806.6..807.6 kbp (1.026 kbp) score=10
PGA1_c07850 LacL family transcriptional regulator PGA1:813..814 kbp (1.032 kbp) score=10
aglE alpha-glucosides-binding periplasmic protein AglE PGA1:814.3..815.6 kbp (1.353 kbp) score=10
aglF alpha-glucoside transport system permease protein AglF PGA1:815.8..816.8 kbp (1.008 kbp) score=10
aglG alpha-glucoside transport system permease protein AglG PGA1:816.8..817.9 kbp (1.149 kbp) score=10
aglK alpha-glucoside transport ATP-binding protein AglK PGA1:819.7..820.8 kbp (1.092 kbp) score=10
PGA1_c07910 hypothetical protein PGA1:820.8..821.8 kbp (1.023 kbp) score=10
PGA1_c07940 hypothetical protein PGA1:824.1..825 kbp (978 bp) score=10
PGA1_c07950 hypothetical protein PGA1:825.2..825.7 kbp (495 bp) score=10
PGA1_c07960 hypothetical protein PGA1:825.7..827.2 kbp (1.518 kbp) score=10
PGA1_c07970 membrane transport protein PGA1:827.3..828.2 kbp (933 bp) score=10
PGA1_c07980 metallo beta-lactamase domain-containing protein PGA1:828.2..829 kbp (798 bp) score=10
PGA1_c08000 hypothetical protein PGA1:829.9..831 kbp (1.122 kbp) score=10
PGA1_c08030 hypothetical protein PGA1:832.9..833.9 kbp (930 bp) score=10
PGA1_c08060 hypothetical protein PGA1:835.2..835.9 kbp (678 bp) score=10
PGA1_c08100 hypothetical protein PGA1:839.2..839.6 kbp (378 bp) score=10
cobW cobalamin biosynthesis protein CobW PGA1:848.2..849.2 kbp (1.08 kbp) score=10
PGA1_c08190 hypothetical protein PGA1:849.2..849.6 kbp (402 bp) score=10
PGA1_c08210 hypothetical protein PGA1:850.8..851.2 kbp (408 bp) score=10
PGA1_c08220 hypothetical protein PGA1:851.2..851.6 kbp (378 bp) score=10
PGA1_c08230 hypothetical protein PGA1:851.6..852.2 kbp (546 bp) score=10
PGA1_c08260 hypothetical protein PGA1:854.9..856 kbp (1.095 kbp) score=10
PGA1_c08270 hypothetical protein PGA1:856..857.1 kbp (1.125 kbp) score=10
PGA1_c08280 hypothetical protein PGA1:857.1..858.5 kbp (1.32 kbp) score=10
PGA1_c08300 hypothetical protein PGA1:860.4..860.9 kbp (507 bp) score=10
PGA1_c08310 hypothetical protein PGA1:860.9..861 kbp (186 bp) score=10
PGA1_c08320 LysR family transcriptional regulator PGA1:861.4..862.2 kbp (822 bp) score=10
PGA1_c08330 hypothetical protein PGA1:862.3..863.2 kbp (912 bp) score=10
PGA1_c08360 hypothetical protein PGA1:866.4..866.8 kbp (402 bp) score=10
PGA1_c08370 hypothetical protein PGA1:866.9..867.3 kbp (402 bp) score=10
tas protein Tas PGA1:867.5..868.5 kbp (1.044 kbp) score=10
PGA1_c08390 AraC family transcriptional regulator PGA1:868.6..869.7 kbp (1.092 kbp) score=10
PGA1_c08400 hypothetical protein PGA1:869.9..870.8 kbp (918 bp) score=10
PGA1_c08410 hypothetical protein PGA1:870.9..871.2 kbp (333 bp) score=10
PGA1_c08440 hypothetical protein PGA1:873.6..874.5 kbp (861 bp) score=10
PGA1_c08450 hypothetical protein PGA1:874.6..874.8 kbp (207 bp) score=10
PGA1_c08470 hypothetical protein PGA1:875.8..876.7 kbp (903 bp) score=10
PGA1_c08480 NUDIX hydrolase-like protein PGA1:876.7..877.5 kbp (768 bp) score=10
PGA1_c08490 hypothetical protein PGA1:877.5..877.9 kbp (417 bp) score=10
PGA1_c08500 hypothetical protein PGA1:878.2..878.7 kbp (504 bp) score=10
PGA1_c08520 hypothetical protein PGA1:879.3..879.8 kbp (477 bp) score=10
PGA1_c08530 hypothetical protein PGA1:879.8..880.3 kbp (480 bp) score=10
PGA1_c08550 hypothetical protein PGA1:882.1..882.4 kbp (285 bp) score=10
PGA1_c08580 hypothetical protein PGA1:885.2..887 kbp (1.791 kbp) score=10
PGA1_c08590 heme NO binding domain-containing protein PGA1:887.1..887.6 kbp (588 bp) score=10
PGA1_c08660 hypothetical protein PGA1:894..894.3 kbp (330 bp) score=10
PGA1_c08670 TetR family transcriptional regulator PGA1:894.4..895 kbp (618 bp) score=10
PGA1_c08680 pirin-like protein PGA1:895.1..896 kbp (912 bp) score=10
PGA1_c08690 hypothetical protein PGA1:896.3..896.8 kbp (516 bp) score=10
PGA1_c08700 hypothetical protein PGA1:896.9..897.5 kbp (600 bp) score=10
PGA1_c08710 hypothetical protein PGA1:897.5..898 kbp (561 bp) score=10
PGA1_c08720 hypothetical protein PGA1:898..899.7 kbp (1.683 kbp) score=10
PGA1_c08730 hypothetical protein PGA1:899.8..899.9 kbp (171 bp) score=10
PGA1_c08780 hypothetical protein PGA1:906.9..907.2 kbp (339 bp) score=10
PGA1_c08810 hypothetical protein PGA1:911.8..912.1 kbp (300 bp) score=10
PGA1_c08830 hypothetical protein PGA1:913.1..913.6 kbp (411 bp) score=10
PGA1_c08840 hypothetical protein PGA1:913.6..914.1 kbp (492 bp) score=10
PGA1_c08850 hypothetical protein PGA1:914.1..914.5 kbp (417 bp) score=10
nrdR transcriptional repressor PGA1:914.7..915.1 kbp (468 bp) score=10
ribD riboflavin biosynthesis protein RibD PGA1:915.2..916.2 kbp (1.077 kbp) score=10
kpsC capsule polysaccharide export protein KpsC PGA1:916.3..918.3 kbp (2.031 kbp) score=10
PGA1_c08890 capsule polysaccharide export outer membrane protein PGA1:918.3..919.5 kbp (1.137 kbp) score=10
kpsS capsule polysaccharide export protein KpsS PGA1:919.6..920.8 kbp (1.293 kbp) score=10
PGA1_c08950 hypothetical protein PGA1:924.4..924.8 kbp (330 bp) score=10
PGA1_c08960 hypothetical protein PGA1:925.2..925.6 kbp (456 bp) score=10
PGA1_c08970 hypothetical protein PGA1:925.7..925.9 kbp (189 bp) score=10
PGA1_c08990 hypothetical protein PGA1:926.3..926.6 kbp (315 bp) score=10
PGA1_c09020 methyl-accepting chemotaxis protein PGA1:929..930.9 kbp (1.935 kbp) score=10
thiG thiazole biosynthesis protein ThiG PGA1:933.6..934.3 kbp (768 bp) score=10
thiS thiamine biosynthesis protein ThiS PGA1:934.3..934.5 kbp (198 bp) score=10
thiC thiamine biosynthesis protein ThiC PGA1:935.5..937.3 kbp (1.8 kbp) score=10
PGA1_c09160 hypothetical protein PGA1:941.8..942.4 kbp (621 bp) score=10
bioC biotin synthesis protein BioC PGA1:942.4..943.2 kbp (789 bp) score=10
PGA1_c09180 hypothetical protein PGA1:943.3..943.8 kbp (528 bp) score=10
PGA1_c09210 hypothetical protein PGA1:945.2..945.8 kbp (564 bp) score=10
PGA1_c09220 hypothetical protein PGA1:946.2..946.7 kbp (471 bp) score=10
PGA1_c09250 hypothetical protein PGA1:948..948.5 kbp (483 bp) score=10
PGA1_c09260 hypothetical protein PGA1:948.7..949.2 kbp (447 bp) score=10
PGA1_c09280 hypothetical protein PGA1:950.2..950.6 kbp (387 bp) score=10
PGA1_c09290 hypothetical protein PGA1:950.7..950.9 kbp (252 bp) score=10
PGA1_c09300 hypothetical protein PGA1:951.1..951.6 kbp (537 bp) score=10
PGA1_c09340 AsnC family transcriptional regulator PGA1:954..954.2 kbp (240 bp) score=10
PGA1_c09410 hypothetical protein PGA1:959.1..959.3 kbp (207 bp) score=10
PGA1_c09460 hypothetical protein PGA1:969.6..969.8 kbp (219 bp) score=10
PGA1_c09470 ATP-binding protein PGA1:970.1..971.2 kbp (1.071 kbp) score=10
mraZ protein MraZ PGA1:971.9..972.5 kbp (582 bp) score=10
PGA1_c09500 hypothetical protein PGA1:973.5..973.9 kbp (375 bp) score=10
PGA1_c09570 HTH-type transcriptional regulator, MarR family PGA1:982.4..982.9 kbp (444 bp) score=10
PGA1_c09580 antibiotic biosynthesis monooxygenase-like protein PGA1:982.9..983.2 kbp (294 bp) score=10
yhiN hypothetical protein PGA1:983.3..984.4 kbp (1.182 kbp) score=10
ftsw cell division protein ftsW PGA1:984.5..985.8 kbp (1.269 kbp) score=10
PGA1_c09630 hypothetical protein PGA1:988.3..988.6 kbp (255 bp) score=10
PGA1_c09640 hypothetical protein PGA1:988.6..988.8 kbp (252 bp) score=10
ftsQ cell division protein FtsQ PGA1:991.2..992 kbp (894 bp) score=10
ftsA celldivision protein FtsA PGA1:992..993.4 kbp (1.335 kbp) score=10
ftsZ cell division protein FtsZ PGA1:993.8..995.6 kbp (1.794 kbp) score=10
PGA1_c09710 outer membrane assembly lipoprotein PGA1:997.3..998.2 kbp (849 bp) score=10
recN DNA repair protein RecN PGA1:998.2..999.9 kbp (1.647 kbp) score=10
PGA1_c09740 hypothetical protein PGA1:1.002..1.002 Mbp (192 bp) score=10
PGA1_c09750 hypothetical protein PGA1:1.002..1.003 Mbp (342 bp) score=10
deaD cold-shock DEAD box protein A PGA1:1.008..1.011 Mbp (2.142 kbp) score=10
PGA1_c09810 hypothetical protein PGA1:1.012..1.012 Mbp (624 bp) score=10
PGA1_c09820 hypothetical protein PGA1:1.013..1.013 Mbp (255 bp) score=10
PGA1_c09830 hypothetical protein PGA1:1.013..1.014 Mbp (720 bp) score=10
PGA1_c09850 S1 domain-containing protein PGA1:1.016..1.018 Mbp (2.367 kbp) score=10
PGA1_c09860 hypothetical protein PGA1:1.018..1.019 Mbp (1.341 kbp) score=10
PGA1_c09870 hypothetical protein PGA1:1.02..1.02 Mbp (453 bp) score=10
PGA1_c09890 hypothetical protein PGA1:1.023..1.023 Mbp (201 bp) score=10
PGA1_c09910 hypothetical protein PGA1:1.025..1.026 Mbp (426 bp) score=10
PGA1_c09960 TetR family transcriptional regulator PGA1:1.03..1.03 Mbp (582 bp) score=10
PGA1_c09990 hypothetical protein PGA1:1.033..1.033 Mbp (399 bp) score=10
soxH protein SoxH PGA1:1.034..1.035 Mbp (954 bp) score=10
PGA1_c10020 hypothetical protein PGA1:1.035..1.036 Mbp (462 bp) score=10
PGA1_c10050 hypothetical protein PGA1:1.039..1.039 Mbp (375 bp) score=10
PGA1_c10060 MerR family transcriptional regulator PGA1:1.039..1.04 Mbp (369 bp) score=10
PGA1_c10070 carboxymuconolactone decarboxylase-like protein PGA1:1.04..1.04 Mbp (372 bp) score=10
PGA1_c10080 hypothetical protein PGA1:1.04..1.042 Mbp (1.281 kbp) score=10
PGA1_c10090 hypothetical protein PGA1:1.042..1.043 Mbp (1.074 kbp) score=10
gsiD2 glutathione transport system permease protein GsiD PGA1:1.043..1.044 Mbp (972 bp) score=10
gsiB1 glutathione-binding protein GsiB PGA1:1.045..1.047 Mbp (1.701 kbp) score=10
gsiA2 glutathione import ATP-binding protein GsiA PGA1:1.047..1.049 Mbp (1.821 kbp) score=10
moaA molybdenum cofactor biosynthesis protein A PGA1:1.056..1.057 Mbp (1.008 kbp) score=10
PGA1_c10210 hypothetical protein PGA1:1.057..1.058 Mbp (471 bp) score=10
PGA1_c10270 hypothetical protein PGA1:1.064..1.065 Mbp (1.065 kbp) score=10
PGA1_c10290 outer membrane protein PGA1:1.067..1.067 Mbp (603 bp) score=10
PGA1_c10310 hypothetical protein PGA1:1.069..1.069 Mbp (336 bp) score=10
PGA1_c10350 hypothetical protein PGA1:1.074..1.074 Mbp (510 bp) score=10
PGA1_c10420 hypothetical protein PGA1:1.079..1.08 Mbp (228 bp) score=10
PGA1_c10440 hypothetical protein PGA1:1.081..1.081 Mbp (351 bp) score=10
PGA1_c10450 hypothetical protein PGA1:1.081..1.082 Mbp (405 bp) score=10
PGA1_c10470 hypothetical protein PGA1:1.084..1.084 Mbp (387 bp) score=10
PGA1_c10500 hypothetical protein PGA1:1.086..1.086 Mbp (420 bp) score=10
PGA1_c10585 hypothetical protein PGA1:1.096..1.096 Mbp (174 bp) score=10
PGA1_c10600 hypothetical protein PGA1:1.098..1.099 Mbp (966 bp) score=10
PGA1_c10610 hypothetical protein PGA1:1.099..1.1 Mbp (747 bp) score=10
PGA1_c10630 hypothetical protein PGA1:1.101..1.102 Mbp (570 bp) score=10
PGA1_c10640 hypothetical protein PGA1:1.102..1.103 Mbp (1.314 kbp) score=10
PGA1_c10660 hypothetical protein PGA1:1.104..1.105 Mbp (1.131 kbp) score=10
PGA1_c10670 putrescine transport ATP-binding protein PGA1:1.105..1.106 Mbp (1.128 kbp) score=10
PGA1_c10680 helix-turn-helix domain-containing protein PGA1:1.106..1.107 Mbp (690 bp) score=10
PGA1_c10690 hypothetical protein PGA1:1.107..1.107 Mbp (309 bp) score=10
PGA1_c10740 hypothetical protein PGA1:1.11..1.111 Mbp (843 bp) score=10
pcm protein-L-isoaspartate O-methyltransferase Pcm PGA1:1.112..1.113 Mbp (648 bp) score=10
PGA1_c10790 hypothetical protein PGA1:1.115..1.115 Mbp (270 bp) score=10
PGA1_c10800 hypothetical protein PGA1:1.115..1.116 Mbp (543 bp) score=10
PGA1_c10820 hypothetical protein PGA1:1.118..1.118 Mbp (705 bp) score=10
radA DNA repair protein RadA PGA1:1.12..1.121 Mbp (1.365 kbp) score=10
PGA1_c10850 hypothetical protein PGA1:1.121..1.122 Mbp (447 bp) score=10
PGA1_c10855 hypothetical protein PGA1:1.122..1.122 Mbp (969 bp) score=10
PGA1_c10860 ABC transporter, ATP binding protein PGA1:1.122..1.123 Mbp (747 bp) score=10
PGA1_c10870 hypothetical protein PGA1:1.123..1.124 Mbp (801 bp) score=10
PGA1_c10920 hypothetical protein PGA1:1.129..1.13 Mbp (960 bp) score=10
PGA1_c10930 hypothetical protein PGA1:1.13..1.131 Mbp (1.068 kbp) score=10
PGA1_c10940 hypothetical protein PGA1:1.131..1.132 Mbp (987 bp) score=10
PGA1_c10950 vWA domain-containing protein PGA1:1.132..1.134 Mbp (1.266 kbp) score=10
PGA1_c10960 outer membrane protein PGA1:1.134..1.136 Mbp (1.875 kbp) score=10
PGA1_c10970 hypothetical protein PGA1:1.136..1.137 Mbp (1.092 kbp) score=10
PGA1_c10980 hypothetical protein PGA1:1.137..1.138 Mbp (1.185 kbp) score=10
PGA1_c10990 hypothetical protein PGA1:1.139..1.14 Mbp (1.416 kbp) score=10
PGA1_c11000 hypothetical protein PGA1:1.14..1.141 Mbp (378 bp) score=10
PGA1_c11010 hypothetical protein PGA1:1.141..1.141 Mbp (363 bp) score=10
PGA1_c11020 hypothetical protein PGA1:1.141..1.142 Mbp (636 bp) score=10
PGA1_c11030 hypothetical protein PGA1:1.142..1.143 Mbp (840 bp) score=10
dksA dnaK suppressor protein DksA PGA1:1.143..1.143 Mbp (447 bp) score=10
cspE cold shock-like protein CspE PGA1:1.145..1.145 Mbp (207 bp) score=10
PGA1_c11090 hypothetical protein PGA1:1.147..1.148 Mbp (1.26 kbp) score=10
PGA1_c11100 hypothetical protein PGA1:1.148..1.149 Mbp (519 bp) score=10
erpA iron-sulfur cluster insertion protein ErpA PGA1:1.149..1.149 Mbp (324 bp) score=10
PGA1_c11130 hypothetical protein PGA1:1.151..1.151 Mbp (315 bp) score=10
PGA1_c11150 hypothetical protein PGA1:1.153..1.154 Mbp (1.383 kbp) score=10
scpA segregation and condensation protein A PGA1:1.155..1.156 Mbp (792 bp) score=10
scpB segregation and condensation protein B PGA1:1.156..1.157 Mbp (663 bp) score=10
PGA1_c11190 hypothetical protein PGA1:1.157..1.157 Mbp (213 bp) score=10
PGA1_c11220 hypothetical protein PGA1:1.159..1.162 Mbp (3.465 kbp) score=10
plsX fatty acid/phospholipid synthesis protein PlsX PGA1:1.163..1.165 Mbp (1.104 kbp) score=10
rpmF 50S ribosomal protein L32 PGA1:1.165..1.165 Mbp (207 bp) score=10
PGA1_c11260 hypothetical protein PGA1:1.165..1.166 Mbp (546 bp) score=10
PGA1_c11270 hypothetical protein PGA1:1.166..1.166 Mbp (468 bp) score=10
PGA1_c11280 hypothetical protein PGA1:1.166..1.167 Mbp (864 bp) score=10
PGA1_c11290 holdfast attachment protein C PGA1:1.167..1.169 Mbp (1.788 kbp) score=10
PGA1_c11300 nodulation protein L PGA1:1.169..1.17 Mbp (555 bp) score=10
PGA1_c11310 hypothetical protein PGA1:1.17..1.17 Mbp (495 bp) score=10
PGA1_c11330 hypothetical protein PGA1:1.171..1.172 Mbp (945 bp) score=10
PGA1_c11360 hypothetical protein PGA1:1.176..1.177 Mbp (1.44 kbp) score=10
PGA1_c11370 hypothetical protein PGA1:1.177..1.178 Mbp (912 bp) score=10
PGA1_c11380 endonuclease-like protein PGA1:1.178..1.179 Mbp (777 bp) score=10
fur ferric uptake regulation protein Fur PGA1:1.181..1.181 Mbp (414 bp) score=10
PGA1_c11410 hypothetical protein PGA1:1.182..1.183 Mbp (897 bp) score=10
PGA1_c11430 hypothetical protein PGA1:1.184..1.185 Mbp (516 bp) score=10
PGA1_c11440 hypothetical protein PGA1:1.185..1.185 Mbp (249 bp) score=10
PGA1_c11450 hypothetical protein PGA1:1.185..1.186 Mbp (276 bp) score=10
PGA1_c11460 hypothetical protein PGA1:1.186..1.186 Mbp (219 bp) score=10
PGA1_c11470 acetyltransferase domain-containing protein PGA1:1.186..1.187 Mbp (450 bp) score=10
PGA1_c11480 hypothetical protein PGA1:1.187..1.187 Mbp (528 bp) score=10
PGA1_c11550 histidine transport system permease protein PGA1:1.195..1.196 Mbp (807 bp) score=10
PGA1_c11560 arginine transport system permease protein PGA1:1.196..1.196 Mbp (717 bp) score=10
PGA1_c11570 nopaline-binding periplasmic protein PGA1:1.197..1.197 Mbp (711 bp) score=10
occP octopine permease ATP-binding protein P PGA1:1.197..1.198 Mbp (780 bp) score=10
PGA1_c11590 hypothetical protein PGA1:1.198..1.199 Mbp (786 bp) score=10
PGA1_c11600 hypothetical protein PGA1:1.199..1.2 Mbp (441 bp) score=10
PGA1_c11610 hypothetical protein PGA1:1.2..1.2 Mbp (552 bp) score=10
PGA1_c11620 hypothetical protein PGA1:1.2..1.201 Mbp (294 bp) score=10
PGA1_c11640 HTH-type transcriptional regulator PGA1:1.204..1.205 Mbp (438 bp) score=10
PGA1_c11670 hypothetical protein PGA1:1.208..1.21 Mbp (1.188 kbp) score=10
PGA1_c11680 acetyltransferase domain-containing protein PGA1:1.21..1.211 Mbp (540 bp) score=10
PGA1_c11690 thioesterase domain-containing protein PGA1:1.211..1.212 Mbp (528 bp) score=10
PGA1_c11710 LysR family transcriptional regulator PGA1:1.213..1.214 Mbp (906 bp) score=10
PGA1_c11770 hypothetical protein PGA1:1.22..1.221 Mbp (633 bp) score=10
PGA1_c11790 two-component regulatory system, sensory/regulatory protein PGA1:1.221..1.224 Mbp (2.529 kbp) score=10
PGA1_c11810 hypothetical protein PGA1:1.226..1.226 Mbp (183 bp) score=10
PGA1_c11830 hypothetical protein PGA1:1.227..1.228 Mbp (366 bp) score=10
PGA1_c11840 hypothetical protein PGA1:1.228..1.228 Mbp (588 bp) score=10
PGA1_c11850 hypothetical protein PGA1:1.228..1.229 Mbp (678 bp) score=10
PGA1_c11860 hypothetical protein PGA1:1.229..1.229 Mbp (285 bp) score=10
PGA1_c11920 hypothetical protein PGA1:1.238..1.239 Mbp (1.098 kbp) score=10
PGA1_c11970 hypothetical protein PGA1:1.243..1.245 Mbp (1.323 kbp) score=10
PGA1_c11980 hypothetical protein PGA1:1.245..1.246 Mbp (1.011 kbp) score=10
PGA1_c12000 hypothetical protein PGA1:1.248..1.248 Mbp (666 bp) score=10
PGA1_c12010 hypothetical protein PGA1:1.249..1.249 Mbp (690 bp) score=10
PGA1_c12070 hypothetical protein PGA1:1.255..1.255 Mbp (213 bp) score=10
PGA1_c12090 transcriptional regulator , MerR family PGA1:1.257..1.258 Mbp (402 bp) score=10
PGA1_c12100 transcriptional regulator , MerR family PGA1:1.258..1.258 Mbp (378 bp) score=10
PGA1_c12110 thioesterase domain-containing protein PGA1:1.259..1.259 Mbp (423 bp) score=10
PGA1_c12120 thioesterase domain-containing protein PGA1:1.259..1.26 Mbp (567 bp) score=10
dinF DNA-damage-inducible protein F PGA1:1.26..1.261 Mbp (1.332 kbp) score=10
PGA1_c12160 hypothetical protein PGA1:1.262..1.263 Mbp (339 bp) score=10
PGA1_c12180 hypothetical protein PGA1:1.264..1.265 Mbp (309 bp) score=10
PGA1_c12190 MarR family transcriptional regulator PGA1:1.265..1.265 Mbp (492 bp) score=10
PGA1_c12280 hypothetical protein PGA1:1.275..1.276 Mbp (564 bp) score=10
PGA1_c12290 hypothetical protein PGA1:1.276..1.276 Mbp (861 bp) score=10
mdoG glucans biosynthesis protein G PGA1:1.278..1.28 Mbp (1.524 kbp) score=10
PGA1_c12320 hypothetical protein PGA1:1.28..1.281 Mbp (1.272 kbp) score=10
PGA1_c12330 hypothetical protein PGA1:1.281..1.283 Mbp (1.365 kbp) score=10
PGA1_c12340 hypothetical protein PGA1:1.283..1.284 Mbp (1.221 kbp) score=10
PGA1_c12360 hypothetical protein PGA1:1.286..1.287 Mbp (540 bp) score=10
PGA1_c12370 hypothetical protein PGA1:1.287..1.288 Mbp (1.071 kbp) score=10
soxR2 regulatory protein SoxR PGA1:1.288..1.288 Mbp (336 bp) score=10
soxS protein SoxS PGA1:1.288..1.289 Mbp (468 bp) score=10
soxV ccdA-like protein SoxV PGA1:1.289..1.29 Mbp (738 bp) score=10
soxY sulfur oxidation protein SoxY PGA1:1.291..1.291 Mbp (417 bp) score=10
soxZ sulfur oxidation protein SoxZ PGA1:1.291..1.292 Mbp (330 bp) score=10
PGA1_c12500 hypothetical protein PGA1:1.298..1.299 Mbp (882 bp) score=10
PGA1_c12510 AraC family transcriptional regulator PGA1:1.299..1.3 Mbp (1.008 kbp) score=10
PGA1_c12540 hypothetical protein PGA1:1.303..1.303 Mbp (360 bp) score=10
PGA1_c12550 hypothetical protein PGA1:1.303..1.303 Mbp (288 bp) score=10
PGA1_c12570 hypothetical protein PGA1:1.304..1.304 Mbp (453 bp) score=10
PGA1_c12580 hypothetical protein PGA1:1.304..1.305 Mbp (363 bp) score=10
aat leucyl/phenylalanyl-tRNA--protein transferase Aat PGA1:1.305..1.305 Mbp (633 bp) score=10
accB biotin carboxyl carrier protein of acetyl-CoA carboxylase PGA1:1.307..1.307 Mbp (498 bp) score=10
PGA1_c12620 AraC family transcriptional regulator PGA1:1.308..1.308 Mbp (537 bp) score=10
PGA1_c12630 high-affinity branched-chain amino acid transport ATP-binding protein PGA1:1.308..1.309 Mbp (756 bp) score=10
PGA1_c12640 high-affinity branched-chain amino acid transport ATP-binding protein PGA1:1.309..1.31 Mbp (756 bp) score=10
PGA1_c12650 high-affinity branched-chain amino acid transport system permease protein PGA1:1.31..1.311 Mbp (1.203 kbp) score=10
PGA1_c12660 high-affinity branched-chain amino acid transport system permease protein PGA1:1.311..1.312 Mbp (1.023 kbp) score=10
PGA1_c12670 hypothetical protein PGA1:1.312..1.314 Mbp (1.347 kbp) score=10
PGA1_c12680 transcriptional regulator PGA1:1.314..1.315 Mbp (1.314 kbp) score=10
PGA1_c12700 hypothetical protein PGA1:1.316..1.316 Mbp (336 bp) score=10
PGA1_c12720 hypothetical protein PGA1:1.319..1.32 Mbp (1.383 kbp) score=10
PGA1_c12730 hypothetical protein PGA1:1.32..1.321 Mbp (450 bp) score=10
PGA1_c12740 hypothetical protein PGA1:1.321..1.321 Mbp (432 bp) score=10
PGA1_c12750 hypothetical protein PGA1:1.321..1.322 Mbp (429 bp) score=10
blh beta-lactamase hydrolase-like protein Blh PGA1:1.322..1.323 Mbp (864 bp) score=10
PGA1_c12770 hypothetical protein PGA1:1.323..1.323 Mbp (231 bp) score=10
PGA1_c12780 hypothetical protein PGA1:1.323..1.323 Mbp (222 bp) score=10
PGA1_c12790 hypothetical protein PGA1:1.324..1.324 Mbp (264 bp) score=10
PGA1_c12800 endoribonuclease-like protein PGA1:1.324..1.325 Mbp (396 bp) score=10
PGA1_c12810 pyridine nucleotide-disulfide oxidoreductase-like protein PGA1:1.325..1.326 Mbp (1.335 kbp) score=10
PGA1_c12820 dihydroorotate dehydrogenase-like protein PGA1:1.326..1.328 Mbp (1.305 kbp) score=10
PGA1_c12830 TetR family transcriptional regulator PGA1:1.328..1.328 Mbp (621 bp) score=10
PGA1_c12860 taurine import ATP-binding protein PGA1:1.331..1.332 Mbp (840 bp) score=10
PGA1_c12890 thiamine biosynthesis protein PGA1:1.334..1.335 Mbp (987 bp) score=10
PGA1_c12900 hypothetical protein PGA1:1.335..1.336 Mbp (219 bp) score=10
PGA1_c12910 hypothetical protein PGA1:1.336..1.337 Mbp (1.32 kbp) score=10
PGA1_c12920 nitrilotriacetate monooxygenase component B-like protein PGA1:1.337..1.338 Mbp (501 bp) score=10
PGA1_c12930 hypothetical protein PGA1:1.338..1.338 Mbp (108 bp) score=10
PGA1_c12960 extracellular solute-binding protein PGA1:1.341..1.342 Mbp (1.017 kbp) score=10
PGA1_c12990 hypothetical protein PGA1:1.345..1.345 Mbp (474 bp) score=10
PGA1_c13000 hypothetical protein PGA1:1.345..1.346 Mbp (369 bp) score=10
PGA1_c13030 tetracycline resistance protein, class C PGA1:1.348..1.349 Mbp (1.215 kbp) score=10
PGA1_c13050 hypothetical protein PGA1:1.35..1.35 Mbp (915 bp) score=10
PGA1_c13080 GntR family transcriptional regulator PGA1:1.353..1.354 Mbp (711 bp) score=10
PGA1_c13140 TRAP transporter extracellular solute binding protein, family 7 PGA1:1.359..1.36 Mbp (1.059 kbp) score=10
PGA1_c13150 di-heme cytochrome c peroxidase-like protein PGA1:1.36..1.362 Mbp (1.8 kbp) score=10
PGA1_c13180 ABC transporter ATP-binding protein PGA1:1.364..1.365 Mbp (1.005 kbp) score=10
PGA1_c13210 extracellular solute-binding protein PGA1:1.367..1.368 Mbp (1.302 kbp) score=10
PGA1_c13220 LacL family transcriptional regulator PGA1:1.368..1.369 Mbp (1.032 kbp) score=10
PGA1_c13240 LysR family transcriptional regulator PGA1:1.369..1.37 Mbp (960 bp) score=10
PGA1_c13250 hypothetical protein PGA1:1.37..1.371 Mbp (987 bp) score=10
PGA1_c13280 hypothetical protein PGA1:1.373..1.373 Mbp (186 bp) score=10
PGA1_c13300 hypothetical protein PGA1:1.375..1.375 Mbp (525 bp) score=10
PGA1_c13320 hypothetical protein PGA1:1.376..1.377 Mbp (711 bp) score=10
PGA1_c13330 glutathione S-transferase domain-containing protein PGA1:1.377..1.377 Mbp (630 bp) score=10
PGA1_c13350 dimethylamine corrinoid protein PGA1:1.378..1.379 Mbp (702 bp) score=10
PGA1_c13360 radical SAM domain-containing protein PGA1:1.379..1.38 Mbp (1.107 kbp) score=10
PGA1_c13380 hypothetical protein PGA1:1.381..1.384 Mbp (2.142 kbp) score=10
PGA1_c13390 hypothetical protein PGA1:1.384..1.384 Mbp (318 bp) score=10
dctB1 C4-dicarboxylate transport sensor protein DctB PGA1:1.386..1.388 Mbp (1.77 kbp) score=10
PGA1_c13470 cytochrome C biogenesis protein, transmembrane region PGA1:1.394..1.394 Mbp (753 bp) score=10
PGA1_c13480 hypothetical protein PGA1:1.395..1.396 Mbp (1.329 kbp) score=10
PGA1_c13500 hypothetical protein PGA1:1.397..1.398 Mbp (219 bp) score=10
PGA1_c13510 hypothetical protein PGA1:1.398..1.398 Mbp (207 bp) score=10
PGA1_c13530 hypothetical protein PGA1:1.399..1.4 Mbp (642 bp) score=10
PGA1_c13540 hypothetical protein PGA1:1.4..1.401 Mbp (477 bp) score=10
PGA1_c13560 hypothetical protein PGA1:1.402..1.403 Mbp (387 bp) score=10
PGA1_c13580 secretion protein, HlyD family PGA1:1.403..1.404 Mbp (1.137 kbp) score=10
PGA1_c13590 ABC transporter ATP-binding protein PGA1:1.404..1.405 Mbp (708 bp) score=10
PGA1_c13600 hypothetical protein PGA1:1.405..1.406 Mbp (1.143 kbp) score=10
PGA1_c13610 hypothetical protein PGA1:1.406..1.408 Mbp (1.203 kbp) score=10
PGA1_c13620 hypothetical protein PGA1:1.408..1.408 Mbp (168 bp) score=10
PGA1_c13630 hypothetical protein PGA1:1.408..1.409 Mbp (948 bp) score=10
PGA1_c13640 hypothetical protein PGA1:1.409..1.409 Mbp (261 bp) score=10
PGA1_c13650 hypothetical protein PGA1:1.409..1.41 Mbp (681 bp) score=10
PGA1_c13660 hypothetical protein PGA1:1.41..1.411 Mbp (537 bp) score=10
PGA1_c13670 hypothetical protein PGA1:1.411..1.412 Mbp (1.377 kbp) score=10
PGA1_c13680 hypothetical protein PGA1:1.412..1.413 Mbp (951 bp) score=10
PGA1_c13690 hypothetical protein PGA1:1.413..1.414 Mbp (927 bp) score=10
PGA1_c13700 hypothetical protein PGA1:1.414..1.414 Mbp (282 bp) score=10
PGA1_c13710 diaminopimelate decarboxylase-like protein PGA1:1.414..1.417 Mbp (2.487 kbp) score=10
PGA1_c13720 hypothetical protein PGA1:1.417..1.418 Mbp (876 bp) score=10
PGA1_c13730 hypothetical protein PGA1:1.418..1.419 Mbp (1.017 kbp) score=10
PGA1_c13750 phosphopantetheine binding protein PGA1:1.42..1.42 Mbp (264 bp) score=10
PGA1_c13790 hypothetical protein PGA1:1.425..1.426 Mbp (1.413 kbp) score=10
PGA1_c13820 4'-phosphopantetheinyl transferase-like protein PGA1:1.429..1.429 Mbp (774 bp) score=10
PGA1_c13830 hypothetical protein PGA1:1.43..1.43 Mbp (591 bp) score=10
PGA1_c13840 AraC family transcriptional regulator PGA1:1.431..1.432 Mbp (1.068 kbp) score=10
PGA1_c13850 hypothetical protein PGA1:1.432..1.433 Mbp (456 bp) score=10
PGA1_c13860 GntR family transcriptional regulator PGA1:1.433..1.434 Mbp (732 bp) score=10
PGA1_c13890 hypothetical protein PGA1:1.437..1.437 Mbp (381 bp) score=10
PGA1_c13930 hypothetical protein PGA1:1.441..1.442 Mbp (441 bp) score=10
PGA1_c13940 ADP-ribose pyrophosphatase-like protein PGA1:1.442..1.443 Mbp (1.125 kbp) score=10
PGA1_c13960 mechanosensitive ion channel protein PGA1:1.444..1.446 Mbp (2.49 kbp) score=10
PGA1_c13970 threonyl/alanyl tRNA synthetase-like protein PGA1:1.446..1.447 Mbp (732 bp) score=10
PGA1_c13990 IacL family transcriptional regulator PGA1:1.448..1.449 Mbp (1.062 kbp) score=10
PGA1_c14020 hypothetical protein PGA1:1.452..1.453 Mbp (618 bp) score=10
PGA1_c14030 hypothetical protein PGA1:1.453..1.453 Mbp (627 bp) score=10
PGA1_c14050 inner membrane protein PGA1:1.456..1.457 Mbp (1.311 kbp) score=10
PGA1_c14070 hypothetical protein PGA1:1.459..1.46 Mbp (1.674 kbp) score=10
PGA1_c14080 hypothetical protein PGA1:1.46..1.46 Mbp (150 bp) score=10
ssb ssDNA-binding protein PGA1:1.465..1.465 Mbp (543 bp) score=10
PGA1_c14140 hypothetical protein PGA1:1.467..1.467 Mbp (375 bp) score=10
gsiA3 glutathione import ATP-binding protein GsiA PGA1:1.467..1.469 Mbp (2.088 kbp) score=10
PGA1_c14160 glutathione transport system permease protein PGA1:1.469..1.471 Mbp (1.443 kbp) score=10
PGA1_c14170 binding-protein-dependent transport system inner membrane component PGA1:1.471..1.472 Mbp (1.053 kbp) score=10
PGA1_c14180 transport system, extracellular solute binding protein PGA1:1.472..1.474 Mbp (1.665 kbp) score=10
PGA1_c14190 AraC family transcriptional regulator PGA1:1.474..1.475 Mbp (825 bp) score=10
PGA1_c14270 hypothetical protein PGA1:1.482..1.482 Mbp (324 bp) score=10
omp outer membrane protein Omp PGA1:1.482..1.485 Mbp (2.397 kbp) score=10
PGA1_c14290 outer membrane protein PGA1:1.485..1.485 Mbp (651 bp) score=10
lpxA acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase LpxA PGA1:1.486..1.487 Mbp (786 bp) score=10
PGA1_c14320 hypothetical protein PGA1:1.487..1.487 Mbp (789 bp) score=10
PGA1_c14350 hypothetical protein PGA1:1.49..1.49 Mbp (279 bp) score=10
PGA1_c14390 hypothetical protein PGA1:1.496..1.497 Mbp (453 bp) score=10
PGA1_c14420 hypothetical protein PGA1:1.498..1.499 Mbp (615 bp) score=10
PGA1_c14440 enoyl-CoA hydratase-like protein PGA1:1.501..1.501 Mbp (789 bp) score=10
PGA1_c14450 thioesterase domain-containing protein PGA1:1.501..1.502 Mbp (423 bp) score=10
PGA1_c14490 hypothetical protein PGA1:1.505..1.505 Mbp (234 bp) score=10
PGA1_c14500 GntR family transcriptional regulator PGA1:1.505..1.506 Mbp (1.416 kbp) score=10
rplM 50S ribosomal protein L13 PGA1:1.506..1.507 Mbp (459 bp) score=10
rpsI 30S ribosomal protein S9 PGA1:1.507..1.507 Mbp (486 bp) score=10
PGA1_c14530 TetR family transcriptional regulator PGA1:1.508..1.508 Mbp (618 bp) score=10
PGA1_c14550 hypothetical protein PGA1:1.509..1.51 Mbp (993 bp) score=10
PGA1_c14570 hypothetical protein PGA1:1.511..1.512 Mbp (864 bp) score=10
PGA1_c14580 hypothetical protein PGA1:1.512..1.513 Mbp (1.146 kbp) score=10
PGA1_c14590 S-adenosylmethionine uptake transporter-like protein PGA1:1.513..1.514 Mbp (903 bp) score=10
PGA1_c14600 hypothetical protein PGA1:1.514..1.516 Mbp (1.581 kbp) score=10
PGA1_c14640 hypothetical protein PGA1:1.52..1.52 Mbp (297 bp) score=10
PGA1_c14650 hypothetical protein PGA1:1.52..1.521 Mbp (1.074 kbp) score=10
PGA1_c14700 hypothetical protein PGA1:1.524..1.525 Mbp (327 bp) score=10
PGA1_c14720 hypothetical protein PGA1:1.526..1.526 Mbp (447 bp) score=10
PGA1_c14740 hypothetical protein PGA1:1.527..1.528 Mbp (483 bp) score=10
ntrB nitrogen regulation protein NtrB PGA1:1.531..1.532 Mbp (1.131 kbp) score=10
ntrC nitrogen regulation protein NtrC PGA1:1.532..1.533 Mbp (1.413 kbp) score=10
ntrY nitrogen regulation protein NtrY PGA1:1.534..1.536 Mbp (2.28 kbp) score=10
ntrX nitrogen assimilation regulatory protein NtrX PGA1:1.536..1.537 Mbp (1.416 kbp) score=10
PGA1_c14820 hypothetical protein PGA1:1.537..1.538 Mbp (546 bp) score=10
trkA trk system potassium uptake protein TrkA PGA1:1.538..1.539 Mbp (1.377 kbp) score=10
trkH trk system potassium uptake protein TrkH PGA1:1.539..1.541 Mbp (1.548 kbp) score=10
hfq protein hfq (RNA chaperone hfq) PGA1:1.541..1.541 Mbp (240 bp) score=10
hflX GTP-binding protein HflX PGA1:1.541..1.542 Mbp (1.272 kbp) score=10
PGA1_c14890 hypothetical protein PGA1:1.546..1.547 Mbp (576 bp) score=10
PGA1_c14910 hypothetical protein PGA1:1.548..1.549 Mbp (525 bp) score=10
PGA1_c14940 DSBA oxidoreductase-like protein PGA1:1.554..1.554 Mbp (672 bp) score=10
PGA1_c14960 transcriptional regulator PGA1:1.556..1.557 Mbp (624 bp) score=10
PGA1_c14970 hypothetical protein PGA1:1.557..1.557 Mbp (231 bp) score=10
PGA1_c14980 major intrinsic protein PGA1:1.557..1.558 Mbp (657 bp) score=10
arsC protein ArsC PGA1:1.558..1.558 Mbp (477 bp) score=10
PGA1_c15000 transcriptional regulator PGA1:1.558..1.559 Mbp (834 bp) score=10
PGA1_c15010 extracellular solute-binding protein PGA1:1.559..1.561 Mbp (1.827 kbp) score=10
PGA1_c15030 phospholipase-like protein PGA1:1.562..1.563 Mbp (1.029 kbp) score=10
PGA1_c15040 hypothetical protein PGA1:1.563..1.564 Mbp (693 bp) score=10
PGA1_c15050 hypothetical protein PGA1:1.564..1.565 Mbp (915 bp) score=10
PGA1_c15070 hypothetical protein PGA1:1.566..1.567 Mbp (846 bp) score=10
PGA1_c15080 hypothetical protein PGA1:1.567..1.568 Mbp (1.209 kbp) score=10
PGA1_c15130 hypothetical protein PGA1:1.573..1.573 Mbp (351 bp) score=10
usg protein Usg PGA1:1.576..1.576 Mbp (270 bp) score=10
PGA1_c15180 hypothetical protein PGA1:1.579..1.579 Mbp (513 bp) score=10
PGA1_c15200 hypothetical protein PGA1:1.58..1.582 Mbp (2.097 kbp) score=10
PGA1_c15230 rRNA methyltransferase-like protein PGA1:1.585..1.586 Mbp (1.212 kbp) score=10
PGA1_c15250 hypothetical protein PGA1:1.589..1.589 Mbp (594 bp) score=10
recA protein recA (recombinase A) PGA1:1.589..1.59 Mbp (1.068 kbp) score=10
PGA1_c15280 hypothetical protein PGA1:1.593..1.594 Mbp (288 bp) score=10
PGA1_c15290 hypothetical protein PGA1:1.594..1.594 Mbp (582 bp) score=10
typA GTP-binding protein TypA PGA1:1.594..1.596 Mbp (1.821 kbp) score=10
PGA1_c15320 hypothetical protein PGA1:1.597..1.598 Mbp (1.173 kbp) score=10
PGA1_c15330 hypothetical protein PGA1:1.598..1.598 Mbp (249 bp) score=10
PGA1_c15340 hypothetical protein PGA1:1.598..1.599 Mbp (654 bp) score=10
PGA1_c15350 transcriptional regulator PGA1:1.599..1.599 Mbp (459 bp) score=10
sufB protein SufB PGA1:1.601..1.602 Mbp (1.524 kbp) score=10
PGA1_c15380 hypothetical protein PGA1:1.602..1.603 Mbp (315 bp) score=10
sufD protein SufD PGA1:1.604..1.605 Mbp (1.281 kbp) score=10
PGA1_c15410 hypothetical protein PGA1:1.605..1.605 Mbp (486 bp) score=10
PGA1_c15420 hypothetical protein PGA1:1.605..1.606 Mbp (582 bp) score=10
PGA1_c15440 hypothetical protein PGA1:1.607..1.609 Mbp (1.659 kbp) score=10
PGA1_c15460 hypothetical protein PGA1:1.609..1.61 Mbp (852 bp) score=10
rplU 50S ribosomal protein L21 PGA1:1.61..1.611 Mbp (591 bp) score=10
rpmA 50S ribosomal protein L27 PGA1:1.611..1.611 Mbp (270 bp) score=10
PGA1_c15500 GTP-binding protein PGA1:1.612..1.613 Mbp (1.035 kbp) score=10
PGA1_c15530 hypothetical protein PGA1:1.616..1.616 Mbp (597 bp) score=10
PGA1_c15540 hypothetical protein PGA1:1.616..1.617 Mbp (186 bp) score=10
PGA1_c15550 hypothetical protein PGA1:1.617..1.617 Mbp (762 bp) score=10
PGA1_c15560 acyltransferase domain-containing protein PGA1:1.617..1.618 Mbp (864 bp) score=10
rpsB 30S ribosomal protein S2 PGA1:1.618..1.619 Mbp (774 bp) score=10
PGA1_c15610 alcohol dehydrogenase, zinc binding protein PGA1:1.622..1.623 Mbp (1.002 kbp) score=10
PGA1_c15620 hypothetical protein PGA1:1.623..1.624 Mbp (1.023 kbp) score=10
PGA1_c15640 IclR family transcriptional regulator PGA1:1.625..1.626 Mbp (795 bp) score=10
PGA1_c15660 enoyl-CoA hydratase/isomerase family protein PGA1:1.626..1.627 Mbp (753 bp) score=10
PGA1_c15700 hypothetical protein PGA1:1.63..1.63 Mbp (276 bp) score=10
phoU phosphate transport system protein PhoU PGA1:1.634..1.635 Mbp (711 bp) score=10
pstB phosphate import ATP-binding protein PstB PGA1:1.635..1.635 Mbp (798 bp) score=10
pstA phosphate transport system permease protein PstA PGA1:1.635..1.637 Mbp (1.371 kbp) score=10
pstC phosphate transport system permease protein PstC PGA1:1.637..1.638 Mbp (1.479 kbp) score=10
PGA1_c15790 phosphate transporter, phosphate-binding protein PGA1:1.638..1.639 Mbp (1.056 kbp) score=10
PGA1_c15820 phenylacetic acid degradation protein PGA1:1.642..1.642 Mbp (522 bp) score=10
PGA1_c15840 hypothetical protein PGA1:1.643..1.644 Mbp (897 bp) score=10
PGA1_c15850 hypothetical protein PGA1:1.644..1.645 Mbp (858 bp) score=10
PGA1_c15870 AraC family transcriptional regulator PGA1:1.647..1.648 Mbp (1.005 kbp) score=10
PGA1_c15910 branched-chain amino acid transport ATP-binding protein PGA1:1.651..1.652 Mbp (789 bp) score=10
PGA1_c15920 branched-chain amino acid transport ATP-binding protein PGA1:1.652..1.652 Mbp (831 bp) score=10
PGA1_c15930 hypothetical protein PGA1:1.652..1.653 Mbp (489 bp) score=10
PGA1_c15940 branched-chain amino acid transport system, permease protein PGA1:1.653..1.654 Mbp (1.011 kbp) score=10
PGA1_c15950 branched-chain amino acid transport system, permease protein PGA1:1.654..1.655 Mbp (1.323 kbp) score=10
PGA1_c15960 hypothetical protein PGA1:1.655..1.657 Mbp (1.545 kbp) score=10
PGA1_c15970 hypothetical protein PGA1:1.657..1.658 Mbp (642 bp) score=10
PGA1_c15990 acyl carrier protein PGA1:1.659..1.66 Mbp (255 bp) score=10
PGA1_c16020 hypothetical protein PGA1:1.663..1.663 Mbp (576 bp) score=10
PGA1_c16040 pterin binding domain-containing protein PGA1:1.664..1.665 Mbp (1.062 kbp) score=10
PGA1_c16050 hypothetical protein PGA1:1.665..1.666 Mbp (933 bp) score=10
PGA1_c16060 hypothetical protein PGA1:1.666..1.666 Mbp (297 bp) score=10
PGA1_c16070 guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase-like protein PGA1:1.667..1.668 Mbp (1.113 kbp) score=10
PGA1_c16120 hypothetical protein PGA1:1.672..1.672 Mbp (381 bp) score=10
PGA1_c16150 hypothetical protein PGA1:1.676..1.677 Mbp (1.107 kbp) score=10
uspF universal stress protein F PGA1:1.677..1.677 Mbp (432 bp) score=10
PGA1_c16170 TRAP transporter, 4TM/12TM fusion protein PGA1:1.677..1.68 Mbp (2.61 kbp) score=10
PGA1_c16190 hypothetical protein PGA1:1.681..1.682 Mbp (180 bp) score=10
PGA1_c16200 molybdopterin dehydrogenase, FAD-binding protein PGA1:1.682..1.683 Mbp (867 bp) score=10
PGA1_c16210 iron-sulfur cluster binding domain-containing protein PGA1:1.683..1.683 Mbp (483 bp) score=10
PGA1_c16220 molybdopterin binding domain-containing protein PGA1:1.683..1.685 Mbp (2.271 kbp) score=10
PGA1_c16230 hypothetical protein PGA1:1.685..1.686 Mbp (291 bp) score=10
PGA1_c16270 periplasmic dipeptide transport protein PGA1:1.689..1.691 Mbp (1.596 kbp) score=10
dppD2 dipeptide transport ATP-binding protein DppD PGA1:1.693..1.693 Mbp (855 bp) score=10
PGA1_c16310 oligopeptide /dipeptide transport ATP-binding protein PGA1:1.693..1.694 Mbp (756 bp) score=10
PGA1_c16340 hypothetical protein PGA1:1.696..1.697 Mbp (579 bp) score=10
PGA1_c16350 hypothetical protein PGA1:1.697..1.697 Mbp (471 bp) score=10
PGA1_c16360 AsnC family transcriptional regulator PGA1:1.697..1.698 Mbp (438 bp) score=10
PGA1_c16380 hypothetical protein/ TnSeq- arginine deiminase (EC 3.5.3.6) PGA1:1.699..1.7 Mbp (930 bp) score=10
PGA1_c16430 DNA repair protein PGA1:1.704..1.704 Mbp (669 bp) score=10
PGA1_c16450 hypothetical protein PGA1:1.706..1.706 Mbp (780 bp) score=10
PGA1_c16460 2-isopropylmalate synthase/homocitrate synthase-like protein PGA1:1.706..1.708 Mbp (1.632 kbp) score=10
PGA1_c16480 outer membrane protein PGA1:1.71..1.71 Mbp (585 bp) score=10
PGA1_c16490 hypothetical protein PGA1:1.711..1.711 Mbp (597 bp) score=10
PGA1_c16510 glycosyl transferase-like protein PGA1:1.713..1.714 Mbp (744 bp) score=10
PGA1_c16520 branched-chain amino acid transporter, ATP-binding protein PGA1:1.714..1.715 Mbp (690 bp) score=10
PGA1_c16530 branched-chain amino acid transporter, ATP-binding protein PGA1:1.715..1.716 Mbp (771 bp) score=10
PGA1_c16560 extracellular ligand binding domain-containing protein PGA1:1.718..1.719 Mbp (1.137 kbp) score=10
PGA1_c16570 hypothetical protein PGA1:1.719..1.72 Mbp (678 bp) score=10
PGA1_c16580 CheR and CheB-like domain-containing protein PGA1:1.72..1.724 Mbp (3.252 kbp) score=10
PGA1_c16610 AsnC family transcriptional regulator PGA1:1.728..1.728 Mbp (489 bp) score=10
PGA1_c16630 hypothetical protein PGA1:1.73..1.732 Mbp (1.446 kbp) score=10
PGA1_c16640 hypothetical protein PGA1:1.732..1.735 Mbp (3.012 kbp) score=10
PGA1_c16680 sugar ABC transporter ATP-binding protein PGA1:1.737..1.738 Mbp (1.068 kbp) score=10
PGA1_c16690 binding protein-dependent transport system, inner membrane component PGA1:1.738..1.738 Mbp (852 bp) score=10
PGA1_c16700 binding protein-dependent transport system, inner membrane component PGA1:1.738..1.739 Mbp (951 bp) score=10
PGA1_c16710 extracellular solute-binding protein PGA1:1.739..1.741 Mbp (1.257 kbp) score=10
PGA1_c16730 GntR family transcriptional regulator PGA1:1.742..1.743 Mbp (747 bp) score=10
PGA1_c16740 diguanylate cyclase domain-containing transport protein PGA1:1.743..1.746 Mbp (2.844 kbp) score=10
PGA1_c16780 hypothetical protein PGA1:1.752..1.753 Mbp (543 bp) score=10
PGA1_c16790 cold shock protein PGA1:1.753..1.753 Mbp (537 bp) score=10
fabI2 enoyl-[acyl-carrier-protein] reductase FabI PGA1:1.754..1.755 Mbp (819 bp) score=10
PGA1_c16820 threonine efflux protein PGA1:1.755..1.756 Mbp (615 bp) score=10
PGA1_c16870 hypothetical protein PGA1:1.761..1.763 Mbp (1.674 kbp) score=10
moaC molybdenum cofactor biosynthesis protein C PGA1:1.766..1.767 Mbp (471 bp) score=10
moeA2 molybdopterin biosynthesis protein MoeA PGA1:1.767..1.768 Mbp (1.173 kbp) score=10
PGA1_c16950 hypothetical protein PGA1:1.769..1.771 Mbp (2.07 kbp) score=10
PGA1_c16980 hypothetical protein PGA1:1.774..1.775 Mbp (897 bp) score=10
ccl cytochrome c-type biogenesis protein Ccl PGA1:1.776..1.777 Mbp (495 bp) score=10
ccmF cytochrome c-type biogenesis protein CcmF PGA1:1.777..1.779 Mbp (1.965 kbp) score=10
PGA1_c17020 hypothetical protein PGA1:1.779..1.779 Mbp (612 bp) score=10
PGA1_c17030 peptidoglycan binding domain-containing protein PGA1:1.779..1.78 Mbp (612 bp) score=10
ccmE cytochrome c-type biogenesis protein CcmE PGA1:1.78..1.781 Mbp (444 bp) score=10
PGA1_c17070 acetyltransferase domain-containing protein PGA1:1.783..1.784 Mbp (951 bp) score=10
PGA1_c17080 pyruvate ferredoxin/flavodoxin oxidoreductase-like protein PGA1:1.784..1.787 Mbp (3.42 kbp) score=10
PGA1_c17090 LysR family transcriptional regulator PGA1:1.787..1.788 Mbp (906 bp) score=10
PGA1_c17100 hypothetical protein PGA1:1.788..1.789 Mbp (195 bp) score=10
PGA1_c17110 hypothetical protein PGA1:1.789..1.789 Mbp (396 bp) score=10
PGA1_c17130 hypothetical protein PGA1:1.792..1.792 Mbp (333 bp) score=10
PGA1_c17140 hypothetical protein PGA1:1.792..1.793 Mbp (531 bp) score=10
PGA1_c17160 hypothetical protein PGA1:1.793..1.793 Mbp (237 bp) score=10
PGA1_c17170 hypothetical protein PGA1:1.793..1.793 Mbp (231 bp) score=10
PGA1_c17190 hypothetical protein PGA1:1.794..1.795 Mbp (681 bp) score=10
PGA1_c17200 TetR family transcriptional regulator PGA1:1.795..1.795 Mbp (477 bp) score=10
PGA1_c17210 cell division protein ZapA PGA1:1.795..1.796 Mbp (399 bp) score=10
PGA1_c17220 hypothetical protein PGA1:1.796..1.797 Mbp (1.029 kbp) score=10
PGA1_c17240 hypothetical protein PGA1:1.8..1.801 Mbp (951 bp) score=10
PGA1_c17260 hypothetical protein PGA1:1.803..1.803 Mbp (144 bp) score=10
PGA1_c17280 cystathionine beta-synthase-like protein PGA1:1.803..1.804 Mbp (435 bp) score=10
PGA1_c17290 LysR family transcriptional regulator PGA1:1.804..1.805 Mbp (897 bp) score=10
PGA1_c17320 hypothetical protein PGA1:1.808..1.809 Mbp (600 bp) score=10
PGA1_c17330 hypothetical protein PGA1:1.809..1.811 Mbp (1.758 kbp) score=10
uvrA uvrABC system protein A PGA1:1.815..1.818 Mbp (2.901 kbp) score=10
PGA1_c17400 hypothetical protein PGA1:1.821..1.821 Mbp (579 bp) score=10
PGA1_c17430 hypothetical protein PGA1:1.824..1.828 Mbp (3.717 kbp) score=10
PGA1_c17450 hypothetical protein PGA1:1.829..1.829 Mbp (882 bp) score=10
PGA1_c17470 hypothetical protein PGA1:1.831..1.832 Mbp (543 bp) score=10
PGA1_c17480 hemolysin-type calcium-binding repeat-containing protein PGA1:1.832..1.833 Mbp (1.245 kbp) score=10
PGA1_c17490 hemolysin-type calcium-binding repeat-containing protein PGA1:1.833..1.835 Mbp (1.497 kbp) score=10
PGA1_c17500 hypothetical protein PGA1:1.835..1.836 Mbp (1.008 kbp) score=10
PGA1_c17540 septum formation initiator-like protein PGA1:1.839..1.839 Mbp (300 bp) score=10
PGA1_c17580 hypothetical protein PGA1:1.844..1.845 Mbp (1.473 kbp) score=10
PGA1_c17590 hypothetical protein PGA1:1.845..1.845 Mbp (339 bp) score=10
PGA1_c17600 serine acetyltransferase-like protein PGA1:1.845..1.846 Mbp (339 bp) score=10
PGA1_c17620 hypothetical protein PGA1:1.847..1.848 Mbp (1.191 kbp) score=10
PGA1_c17630 hypothetical protein PGA1:1.848..1.849 Mbp (690 bp) score=10
PGA1_c17640 hypothetical protein PGA1:1.849..1.849 Mbp (354 bp) score=10
PGA1_c17650 hypothetical protein PGA1:1.849..1.85 Mbp (279 bp) score=10
PGA1_c17660 hypothetical protein PGA1:1.85..1.85 Mbp (189 bp) score=10
PGA1_c17670 CRP family transcriptional regulator PGA1:1.85..1.851 Mbp (759 bp) score=10
PGA1_c17680 hypothetical protein PGA1:1.851..1.852 Mbp (237 bp) score=10
PGA1_c17700 hypothetical protein PGA1:1.853..1.853 Mbp (297 bp) score=10
PGA1_c17710 gene transfer agent protein PGA1:1.853..1.857 Mbp (3.969 kbp) score=10
PGA1_c17730 hypothetical protein PGA1:1.858..1.859 Mbp (951 bp) score=10
PGA1_c17740 gene transfer agent protein PGA1:1.859..1.859 Mbp (633 bp) score=10
PGA1_c17750 gene transfer agent tail tape measure protein PGA1:1.859..1.86 Mbp (657 bp) score=10
PGA1_c17760 hypothetical protein PGA1:1.86..1.86 Mbp (258 bp) score=10
PGA1_c17770 hypothetical protein PGA1:1.86..1.861 Mbp (405 bp) score=10
PGA1_c17780 gene transfer agent major tail protein PGA1:1.861..1.861 Mbp (414 bp) score=10
PGA1_c17790 gene transfer agent protein PGA1:1.861..1.862 Mbp (408 bp) score=10
PGA1_c17810 gene transfer agent protein PGA1:1.862..1.863 Mbp (651 bp) score=10
PGA1_c17820 hypothetical protein PGA1:1.863..1.864 Mbp (1.185 kbp) score=10
PGA1_c17840 hypothetical protein PGA1:1.865..1.865 Mbp (219 bp) score=10
PGA1_c17850 gene transfer agent portal protein PGA1:1.865..1.866 Mbp (1.194 kbp) score=10
PGA1_c17870 hypothetical protein PGA1:1.868..1.868 Mbp (342 bp) score=10
PGA1_c17910 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase-like protein PGA1:1.872..1.873 Mbp (744 bp) score=10
acpP acyl carrier protein AcpP PGA1:1.873..1.873 Mbp (234 bp) score=10
fabD malonyl CoA-acyl carrier protein transacylase FabD PGA1:1.875..1.876 Mbp (933 bp) score=10
PGA1_c17950 hypothetical protein PGA1:1.876..1.877 Mbp (1.305 kbp) score=10
PGA1_c17970 hypothetical protein PGA1:1.879..1.88 Mbp (885 bp) score=10
csaA protein CsaA PGA1:1.88..1.88 Mbp (339 bp) score=10
PGA1_c18030 hypothetical protein PGA1:1.885..1.886 Mbp (795 bp) score=10
PGA1_c18040 hypothetical protein PGA1:1.886..1.886 Mbp (603 bp) score=10
PGA1_c18050 hypothetical protein PGA1:1.887..1.887 Mbp (576 bp) score=10
PGA1_c18060 hypothetical protein PGA1:1.887..1.888 Mbp (597 bp) score=10
PGA1_c18080 hypothetical protein PGA1:1.888..1.889 Mbp (333 bp) score=10
rpsF 30S ribosomal protein S6 PGA1:1.889..1.889 Mbp (354 bp) score=10
rpsR 30S ribosomal protein S18 PGA1:1.889..1.889 Mbp (228 bp) score=10
rplI 50S ribosomal protein L9 PGA1:1.889..1.89 Mbp (618 bp) score=10
PGA1_c18150 hypothetical protein PGA1:1.893..1.895 Mbp (1.269 kbp) score=10
PGA1_c18170 hypothetical protein PGA1:1.897..1.898 Mbp (1.131 kbp) score=10
PGA1_c18180 methyl-accepting chemotaxis protein PGA1:1.898..1.9 Mbp (2.205 kbp) score=10
PGA1_c18195 hypothetical protein PGA1:1.901..1.902 Mbp (417 bp) score=10
PGA1_c18200 hypothetical protein PGA1:1.902..1.905 Mbp (2.967 kbp) score=10
PGA1_c18210 phage late control gene D protein (GPD) PGA1:1.906..1.907 Mbp (1.008 kbp) score=10
PGA1_c18220 phage tail protein X PGA1:1.907..1.907 Mbp (222 bp) score=10
PGA1_c18230 phage-related tail protein (gpU) PGA1:1.907..1.907 Mbp (411 bp) score=10
PGA1_c18240 phage tail tape measure protein PGA1:1.907..1.91 Mbp (2.496 kbp) score=10
PGA1_c18250 hypothetical protein PGA1:1.91..1.91 Mbp (294 bp) score=10
PGA1_c18260 phage major tail tube protein PGA1:1.91..1.911 Mbp (507 bp) score=10
PGA1_c18270 major tail sheath protein PGA1:1.911..1.912 Mbp (1.218 kbp) score=10
PGA1_c18280 hypothetical protein PGA1:1.912..1.912 Mbp (450 bp) score=10
PGA1_c18290 hypothetical protein PGA1:1.912..1.913 Mbp (411 bp) score=10
PGA1_c18300 hypothetical protein PGA1:1.913..1.914 Mbp (1.158 kbp) score=10
PGA1_c18310 hypothetical protein PGA1:1.914..1.914 Mbp (558 bp) score=10
PGA1_c18320 phage tail protein I PGA1:1.914..1.915 Mbp (603 bp) score=10
PGA1_c18330 baseplate assembly protein J PGA1:1.915..1.916 Mbp (900 bp) score=10
PGA1_c18340 baseplate assembly protein W PGA1:1.916..1.916 Mbp (453 bp) score=10
PGA1_c18350 baseplate assembly protein V PGA1:1.917..1.917 Mbp (426 bp) score=10
PGA1_c18360 hypothetical protein PGA1:1.917..1.918 Mbp (534 bp) score=10
PGA1_c18370 hypothetical protein PGA1:1.918..1.918 Mbp (552 bp) score=10
PGA1_c18380 hypothetical protein PGA1:1.918..1.918 Mbp (312 bp) score=10
PGA1_c18390 hypothetical protein PGA1:1.918..1.919 Mbp (231 bp) score=10
PGA1_c18400 peptidase U35, phage prohead HK97-like protein PGA1:1.919..1.921 Mbp (2.031 kbp) score=10
PGA1_c18410 phage portal protein, lambda family PGA1:1.921..1.922 Mbp (1.527 kbp) score=10
PGA1_c18420 hypothetical protein PGA1:1.922..1.923 Mbp (531 bp) score=10
PGA1_c18450 hypothetical protein PGA1:1.926..1.926 Mbp (378 bp) score=10
PGA1_c18460 hypothetical protein PGA1:1.926..1.927 Mbp (753 bp) score=10
PGA1_c18470 hypothetical protein PGA1:1.927..1.927 Mbp (246 bp) score=10
PGA1_c18480 hypothetical protein PGA1:1.927..1.928 Mbp (726 bp) score=10
PGA1_c18490 hypothetical protein PGA1:1.928..1.929 Mbp (1.287 kbp) score=10
PGA1_c18500 hypothetical protein PGA1:1.93..1.93 Mbp (567 bp) score=10
PGA1_c18510 hypothetical protein PGA1:1.93..1.931 Mbp (417 bp) score=10
PGA1_c18520 hypothetical protein PGA1:1.931..1.931 Mbp (261 bp) score=10
PGA1_c18530 hypothetical protein PGA1:1.931..1.931 Mbp (309 bp) score=10
PGA1_c18540 hypothetical protein PGA1:1.931..1.932 Mbp (948 bp) score=10
PGA1_c18550 hypothetical protein PGA1:1.932..1.933 Mbp (603 bp) score=10
PGA1_c18560 hypothetical protein PGA1:1.933..1.933 Mbp (174 bp) score=10
PGA1_c18570 hypothetical protein PGA1:1.933..1.933 Mbp (324 bp) score=10
PGA1_c18580 hypothetical protein PGA1:1.933..1.934 Mbp (222 bp) score=10
PGA1_c18590 hypothetical protein PGA1:1.934..1.934 Mbp (360 bp) score=10
PGA1_c18600 hypothetical protein PGA1:1.934..1.935 Mbp (903 bp) score=10
PGA1_c18610 hypothetical protein PGA1:1.935..1.936 Mbp (507 bp) score=10
PGA1_c18620 hypothetical protein PGA1:1.936..1.936 Mbp (243 bp) score=10
PGA1_c18630 hypothetical protein PGA1:1.936..1.937 Mbp (231 bp) score=10
PGA1_c18640 hypothetical protein PGA1:1.937..1.937 Mbp (225 bp) score=10
PGA1_c18650 hypothetical protein PGA1:1.937..1.938 Mbp (351 bp) score=10
PGA1_c18660 hypothetical protein PGA1:1.938..1.938 Mbp (291 bp) score=10
PGA1_c18670 hypothetical protein PGA1:1.938..1.938 Mbp (171 bp) score=10
PGA1_c18680 hypothetical protein PGA1:1.938..1.939 Mbp (1.002 kbp) score=10
PGA1_c18700 hypothetical protein PGA1:1.94..1.941 Mbp (1.698 kbp) score=10
glnB1 nitrogen regulatory protein P-II PGA1:1.942..1.942 Mbp (339 bp) score=10
PGA1_c18730 hypothetical protein PGA1:1.944..1.945 Mbp (1.026 kbp) score=10
PGA1_c18740 hypothetical protein PGA1:1.945..1.946 Mbp (765 bp) score=10
dddP protein DddP (metallopeptidase, family M24), DMSP degrading PGA1:1.946..1.947 Mbp (1.392 kbp) score=10
PGA1_c18760 hypothetical protein PGA1:1.947..1.948 Mbp (561 bp) score=10
PGA1_c18770 hypothetical protein PGA1:1.948..1.949 Mbp (1.257 kbp) score=10
PGA1_c18790 hypothetical protein PGA1:1.951..1.952 Mbp (606 bp) score=10
fliG flagellar motor switch protein FliG PGA1:1.952..1.953 Mbp (1.194 kbp) score=10
PGA1_c18820 hypothetical protein PGA1:1.954..1.955 Mbp (732 bp) score=10
PGA1_c18850 hypothetical protein PGA1:1.958..1.958 Mbp (312 bp) score=10
ccmG thiol:disulfide interchange protein CcmG PGA1:1.959..1.959 Mbp (540 bp) score=10
ccmD heme exporter protein D PGA1:1.959..1.959 Mbp (174 bp) score=10
ccmC heme exporter protein C PGA1:1.959..1.96 Mbp (732 bp) score=10
ccmB heme exporter protein B PGA1:1.96..1.961 Mbp (657 bp) score=10
ccmA cytochrome c biogenesis ATP-binding export protein CcmA PGA1:1.961..1.961 Mbp (621 bp) score=10
PGA1_c18900 hypothetical protein PGA1:1.961..1.962 Mbp (354 bp) score=10
PGA1_c18950 hypothetical protein PGA1:1.965..1.966 Mbp (1.296 kbp) score=10
PGA1_c18970 hypothetical protein PGA1:1.968..1.969 Mbp (723 bp) score=10
engA GTP-binding protein EngA PGA1:1.97..1.971 Mbp (1.461 kbp) score=10
PGA1_c19000 quinoprotein PGA1:1.971..1.973 Mbp (1.323 kbp) score=10
PGA1_c19010 hypothetical protein PGA1:1.973..1.973 Mbp (672 bp) score=10
mdtC multidrug resistance protein MdtC PGA1:1.975..1.979 Mbp (3.807 kbp) score=10
PGA1_c19050 hypothetical protein PGA1:1.979..1.979 Mbp (228 bp) score=10
PGA1_c19060 ABC transporter ATP-binding protein PGA1:1.979..1.981 Mbp (1.809 kbp) score=10
PGA1_c19070 hypothetical protein PGA1:1.981..1.983 Mbp (1.788 kbp) score=10
PGA1_c19080 hypothetical protein PGA1:1.983..1.984 Mbp (543 bp) score=10
PGA1_c19090 hypothetical protein PGA1:1.984..1.984 Mbp (453 bp) score=10
PGA1_c19100 hypothetical protein PGA1:1.984..1.984 Mbp (201 bp) score=10
PGA1_c19120 hypothetical protein PGA1:1.985..1.986 Mbp (498 bp) score=10
PGA1_c19130 hypothetical protein PGA1:1.986..1.986 Mbp (456 bp) score=10
PGA1_c19140 sarcosine oxidase-like protein PGA1:1.987..1.987 Mbp (573 bp) score=10
cycH cytochrome c-type biogenesis protein CycH PGA1:1.992..1.993 Mbp (1.257 kbp) score=10
PGA1_c19190 hypothetical protein PGA1:1.993..1.994 Mbp (474 bp) score=10
PGA1_c19200 hypothetical protein PGA1:1.994..1.994 Mbp (234 bp) score=10
PGA1_c19210 hypothetical protein PGA1:1.994..1.995 Mbp (795 bp) score=10
PGA1_c19220 hypothetical protein PGA1:1.995..1.996 Mbp (867 bp) score=10
PGA1_c19240 phage integrase protein PGA1:1.997..1.998 Mbp (1.161 kbp) score=10
PGA1_c19260 hypothetical protein PGA1:1.999..1.999 Mbp (474 bp) score=10
PGA1_c19270 hypothetical protein PGA1:1.999..2.004 Mbp (5.205 kbp) score=10
PGA1_c19280 hypothetical protein PGA1:2.005..2.006 Mbp (1.044 kbp) score=10
PGA1_c19290 hypothetical protein PGA1:2.006..2.006 Mbp (687 bp) score=10
PGA1_c19300 hypothetical protein PGA1:2.007..2.008 Mbp (1.194 kbp) score=10
PGA1_c19310 hypothetical protein PGA1:2.008..2.01 Mbp (2.064 kbp) score=10
PGA1_c19340 aldehyde dehydrogenase-like protein PGA1:2.013..2.013 Mbp (342 bp) score=10
PGA1_c19400 leucine-responsive regulatory protein PGA1:2.018..2.019 Mbp (465 bp) score=10
PGA1_c19420 hypothetical protein PGA1:2.021..2.022 Mbp (297 bp) score=10
PGA1_c19450 hypothetical protein PGA1:2.023..2.024 Mbp (681 bp) score=10
PGA1_c19470 ABC transporter ATP-binding protein PGA1:2.025..2.026 Mbp (1.092 kbp) score=10
PGA1_c19480 ABC transporter, inner-membrane protein PGA1:2.026..2.027 Mbp (894 bp) score=10
PGA1_c19490 ABC transporter, inner-membrane protein PGA1:2.027..2.028 Mbp (885 bp) score=10
PGA1_c19500 sugar-binding periplasmic protein PGA1:2.028..2.029 Mbp (1.245 kbp) score=10
PGA1_c19530 hypothetical protein PGA1:2.031..2.031 Mbp (330 bp) score=10
PGA1_c19540 hypothetical protein PGA1:2.031..2.032 Mbp (615 bp) score=10
PGA1_c19550 hypothetical protein PGA1:2.032..2.032 Mbp (465 bp) score=10
PGA1_c19560 hypothetical protein PGA1:2.033..2.033 Mbp (720 bp) score=10
PGA1_c19570 hypothetical protein PGA1:2.034..2.034 Mbp (342 bp) score=10
PGA1_c19580 hypothetical protein PGA1:2.034..2.034 Mbp (219 bp) score=10
PGA1_c19590 hypothetical protein PGA1:2.034..2.035 Mbp (732 bp) score=10
PGA1_c19600 hypothetical protein PGA1:2.035..2.036 Mbp (495 bp) score=10
PGA1_c19610 hypothetical protein PGA1:2.036..2.036 Mbp (174 bp) score=10
tdaH oxidoreductase, molybdopterin binding protein PGA1:2.039..2.039 Mbp (633 bp) score=10
PGA1_c19640 transcriptional regulator, containing response regulator domain PGA1:2.04..2.04 Mbp (615 bp) score=10
PGA1_c19650 hypothetical protein PGA1:2.04..2.041 Mbp (168 bp) score=10
PGA1_c19680 CRP family transcriptional regulator PGA1:2.043..2.044 Mbp (669 bp) score=10
PGA1_c19690 hypothetical protein PGA1:2.044..2.044 Mbp (213 bp) score=10
PGA1_c19720 hypothetical protein PGA1:2.048..2.048 Mbp (330 bp) score=10
PGA1_c19730 hypothetical protein PGA1:2.048..2.048 Mbp (171 bp) score=10
PGA1_c19740 hypothetical protein PGA1:2.048..2.049 Mbp (525 bp) score=10
PGA1_c19760 ABC transporter ATP-binding protein PGA1:2.05..2.052 Mbp (1.854 kbp) score=10
PGA1_c19770 hypothetical protein PGA1:2.052..2.052 Mbp (621 bp) score=10
PGA1_c19780 hypothetical protein PGA1:2.052..2.053 Mbp (582 bp) score=10
PGA1_c19810 hypothetical protein PGA1:2.055..2.056 Mbp (1.152 kbp) score=10
PGA1_c19820 hypothetical protein PGA1:2.056..2.057 Mbp (1.104 kbp) score=10
PGA1_c19830 organic solvent tolerance protein PGA1:2.057..2.06 Mbp (2.19 kbp) score=10
PGA1_c19870 hypothetical protein PGA1:2.063..2.064 Mbp (720 bp) score=10
PGA1_c19900 hypothetical protein PGA1:2.066..2.066 Mbp (399 bp) score=10
PGA1_c19910 hypothetical protein PGA1:2.066..2.067 Mbp (423 bp) score=10
mazG protein MazG PGA1:2.07..2.071 Mbp (837 bp) score=10
PGA1_c19970 hypothetical protein PGA1:2.072..2.073 Mbp (996 bp) score=10
PGA1_c19980 hypothetical protein PGA1:2.073..2.073 Mbp (543 bp) score=10
PGA1_c20000 hypothetical protein PGA1:2.075..2.075 Mbp (291 bp) score=10
PGA1_c20020 hypothetical protein PGA1:2.078..2.079 Mbp (336 bp) score=10
PGA1_c20050 hypothetical protein PGA1:2.08..2.081 Mbp (768 bp) score=10
PGA1_c20060 hypothetical protein PGA1:2.081..2.081 Mbp (228 bp) score=10
PGA1_c20100 hypothetical protein PGA1:2.084..2.085 Mbp (372 bp) score=10
PGA1_c20110 hypothetical protein PGA1:2.085..2.087 Mbp (1.647 kbp) score=10
PGA1_c20120 hypothetical protein PGA1:2.087..2.087 Mbp (471 bp) score=10
PGA1_c20130 hypothetical protein PGA1:2.088..2.088 Mbp (432 bp) score=10
PGA1_c20140 arginine-tRNA-protein transferase PGA1:2.088..2.089 Mbp (822 bp) score=10
PGA1_c20150 glyoxalase-like protein PGA1:2.089..2.089 Mbp (384 bp) score=10
PGA1_c20170 hypothetical protein PGA1:2.092..2.093 Mbp (927 bp) score=10
PGA1_c20230 hypothetical protein PGA1:2.1..2.1 Mbp (483 bp) score=10
PGA1_c20240 hypothetical protein PGA1:2.1..2.101 Mbp (807 bp) score=10
PGA1_c20250 hypothetical protein PGA1:2.101..2.102 Mbp (771 bp) score=10
mrcA penicillin-binding protein 1A MrcA PGA1:2.105..2.107 Mbp (2.502 kbp) score=10
PGA1_c20320 hypothetical protein PGA1:2.112..2.112 Mbp (774 bp) score=10
PGA1_c20340 hypothetical protein PGA1:2.114..2.115 Mbp (1.224 kbp) score=10
PGA1_c20400 hypothetical protein PGA1:2.119..2.119 Mbp (372 bp) score=10
PGA1_c20430 hypothetical protein PGA1:2.12..2.121 Mbp (423 bp) score=10
PGA1_c20440 hypothetical protein PGA1:2.121..2.121 Mbp (345 bp) score=10
PGA1_c20450 hypothetical protein PGA1:2.121..2.121 Mbp (192 bp) score=10
PGA1_c20460 hypothetical protein PGA1:2.122..2.123 Mbp (1.023 kbp) score=10
PGA1_c20470 hypothetical protein PGA1:2.123..2.123 Mbp (636 bp) score=10
PGA1_c20490 AsnC family transcriptional regulator PGA1:2.124..2.124 Mbp (456 bp) score=10
PGA1_c20510 hypothetical protein PGA1:2.126..2.126 Mbp (273 bp) score=10
PGA1_c20520 acetyltransferase and methytransferase domain-containing protein PGA1:2.126..2.127 Mbp (1.038 kbp) score=10
PGA1_c20530 transcriptional regulator PGA1:2.127..2.128 Mbp (423 bp) score=10
PGA1_c20535 hypothetical protein PGA1:2.128..2.128 Mbp (408 bp) score=10
PGA1_c20550 hypothetical protein PGA1:2.131..2.132 Mbp (462 bp) score=10
PGA1_c20560 hypothetical protein PGA1:2.132..2.133 Mbp (696 bp) score=10
qmcA protein QmcA PGA1:2.134..2.135 Mbp (894 bp) score=10
PGA1_c20590 hypothetical protein PGA1:2.135..2.135 Mbp (279 bp) score=10
PGA1_c20600 hypothetical protein PGA1:2.135..2.136 Mbp (675 bp) score=10
PGA1_c20620 hypothetical protein PGA1:2.137..2.138 Mbp (363 bp) score=10
PGA1_c20630 glycerophosphoryl diester phosphodiesterase-like protein PGA1:2.138..2.139 Mbp (1.26 kbp) score=10
iscA iron-binding protein IscA PGA1:2.139..2.14 Mbp (360 bp) score=10
dctP3 C4-dicarboxylate-binding periplasmic protein DctP PGA1:2.143..2.144 Mbp (1.002 kbp) score=10
dctB2 C4-dicarboxylate transport sensor protein DctB PGA1:2.146..2.148 Mbp (1.8 kbp) score=10
PGA1_c20730 AsnC family transcriptional regulator PGA1:2.151..2.151 Mbp (480 bp) score=10
PGA1_c20750 hypothetical protein PGA1:2.152..2.152 Mbp (309 bp) score=10
PGA1_c20780 hypothetical protein PGA1:2.155..2.155 Mbp (399 bp) score=10
PGA1_c20800 hypothetical protein PGA1:2.156..2.157 Mbp (516 bp) score=10
PGA1_c20820 hypothetical protein PGA1:2.159..2.159 Mbp (654 bp) score=10
PGA1_c20830 hypothetical protein PGA1:2.16..2.16 Mbp (780 bp) score=10
PGA1_c20860 molybdenum hydroxylase family protein, medium subunit PGA1:2.162..2.163 Mbp (789 bp) score=10
PGA1_c20870 molybdenum hydroxylase family protein, large subunit PGA1:2.163..2.165 Mbp (2.364 kbp) score=10
PGA1_c20880 molybdenum hydroxylase family protein, small subunit PGA1:2.166..2.166 Mbp (486 bp) score=10
PGA1_c20890 hypothetical protein PGA1:2.166..2.167 Mbp (1.005 kbp) score=10
PGA1_c20900 hypothetical protein PGA1:2.167..2.168 Mbp (1.023 kbp) score=10
phaR PHA synthesis repressor protein PhaR PGA1:2.168..2.169 Mbp (561 bp) score=10
phaP granule associated protein (phasin) PGA1:2.169..2.17 Mbp (444 bp) score=10
PGA1_c20950 hypothetical protein PGA1:2.173..2.174 Mbp (573 bp) score=10
PGA1_c20960 carboxylesterase bioH-like protein PGA1:2.174..2.175 Mbp (891 bp) score=10
PGA1_c20970 alpha/beta hydrolase domain-containing protein PGA1:2.175..2.176 Mbp (780 bp) score=10
PGA1_c20980 hypothetical protein PGA1:2.176..2.177 Mbp (1.005 kbp) score=10
PGA1_c21000 hypothetical protein PGA1:2.18..2.18 Mbp (306 bp) score=10
PGA1_c21010 hypothetical protein PGA1:2.18..2.181 Mbp (849 bp) score=10
PGA1_c21020 hypothetical protein PGA1:2.181..2.182 Mbp (756 bp) score=10
PGA1_c21030 hypothetical protein PGA1:2.182..2.182 Mbp (537 bp) score=10
PGA1_c21040 hypothetical protein PGA1:2.182..2.183 Mbp (369 bp) score=10
PGA1_c21050 glutaredoxin-like protein PGA1:2.183..2.183 Mbp (321 bp) score=10
cspA1 cold shock protein CspA PGA1:2.183..2.183 Mbp (207 bp) score=10
PGA1_c21100 hypothetical protein PGA1:2.187..2.188 Mbp (819 bp) score=10
PGA1_c21110 hypothetical protein PGA1:2.188..2.188 Mbp (603 bp) score=10
PGA1_c21120 GntR family transcriptional regulator PGA1:2.188..2.189 Mbp (711 bp) score=10
PGA1_c21130 hypothetical protein PGA1:2.189..2.189 Mbp (294 bp) score=10
PGA1_c21140 carboxymuconolactone decarboxylase-like protein PGA1:2.189..2.19 Mbp (423 bp) score=10
PGA1_c21150 Asp/Glu/hydantoin racemase-like protein PGA1:2.19..2.191 Mbp (795 bp) score=10
PGA1_c21190 hypothetical protein PGA1:2.194..2.195 Mbp (939 bp) score=10
PGA1_c21200 hypothetical protein PGA1:2.195..2.196 Mbp (1.425 kbp) score=10
PGA1_c21220 MarR family transcriptional regulator PGA1:2.197..2.198 Mbp (504 bp) score=10
PGA1_c21230 hypothetical protein PGA1:2.198..2.198 Mbp (261 bp) score=10
PGA1_c21240 helix-turn-helix domain-containing protein PGA1:2.198..2.198 Mbp (396 bp) score=10
PGA1_c21260 hypothetical protein PGA1:2.2..2.2 Mbp (423 bp) score=10
PGA1_c21270 hypothetical protein PGA1:2.2..2.201 Mbp (867 bp) score=10
PGA1_c21280 LysR family transcriptional regulator PGA1:2.202..2.202 Mbp (915 bp) score=10
norM multidrug resistance protein NorM PGA1:2.205..2.207 Mbp (1.395 kbp) score=10
PGA1_c21320 hypothetical protein PGA1:2.207..2.208 Mbp (735 bp) score=10
PGA1_c21330 hypothetical protein PGA1:2.208..2.208 Mbp (609 bp) score=10
PGA1_c21360 hypothetical protein PGA1:2.212..2.213 Mbp (792 bp) score=10
PGA1_c21370 hypothetical protein PGA1:2.213..2.214 Mbp (753 bp) score=10
PGA1_c21390 hypothetical protein PGA1:2.216..2.217 Mbp (687 bp) score=10
PGA1_c21440 hypothetical protein PGA1:2.222..2.223 Mbp (771 bp) score=10
PGA1_c21450 phosphatase-like protein PGA1:2.223..2.224 Mbp (1.545 kbp) score=10
PGA1_c21460 hypothetical protein PGA1:2.224..2.225 Mbp (441 bp) score=10
PGA1_c21470 endonuclease/exonuclease/phosphatase family protein PGA1:2.225..2.226 Mbp (996 bp) score=10
PGA1_c21480 dnaJ domain-containing protein PGA1:2.226..2.227 Mbp (699 bp) score=10
PGA1_c21500 hypothetical protein PGA1:2.227..2.228 Mbp (603 bp) score=10
PGA1_c21520 hypothetical protein PGA1:2.23..2.231 Mbp (936 bp) score=10
PGA1_c21525 hypothetical protein PGA1:2.231..2.232 Mbp (606 bp) score=10
PGA1_c21530 hypothetical protein PGA1:2.232..2.232 Mbp (528 bp) score=10
PGA1_c21550 hypothetical protein PGA1:2.235..2.235 Mbp (204 bp) score=10
PGA1_c21560 hypothetical protein PGA1:2.235..2.236 Mbp (357 bp) score=10
PGA1_c21570 hypothetical protein PGA1:2.236..2.236 Mbp (141 bp) score=10
PGA1_c21580 hypothetical protein PGA1:2.236..2.237 Mbp (519 bp) score=10
PGA1_c21590 hypothetical protein PGA1:2.237..2.237 Mbp (192 bp) score=10
PGA1_c21620 bicyclomycin resistance protein PGA1:2.24..2.241 Mbp (1.212 kbp) score=10
PGA1_c21630 transcriptional regulator PGA1:2.241..2.243 Mbp (1.389 kbp) score=10
PGA1_c21640 hypothetical protein PGA1:2.243..2.243 Mbp (189 bp) score=10
PGA1_c21650 hypothetical protein PGA1:2.244..2.244 Mbp (240 bp) score=10
betI HTH-type transcriptional regulator PGA1:2.25..2.251 Mbp (576 bp) score=10
PGA1_c21710 hypothetical protein PGA1:2.251..2.252 Mbp (1.095 kbp) score=10
PGA1_c21730 arginine exporter protein PGA1:2.253..2.254 Mbp (606 bp) score=10
PGA1_c21740 ArgP family transcriptional regulator PGA1:2.254..2.255 Mbp (885 bp) score=10
PGA1_c21750 hypothetical protein PGA1:2.255..2.256 Mbp (921 bp) score=10
PGA1_c21770 hypothetical protein PGA1:2.256..2.257 Mbp (741 bp) score=10
PGA1_c21810 hypothetical protein PGA1:2.263..2.264 Mbp (813 bp) score=10
PGA1_c21820 5-formyltetrahydrofolate cycloligase-like protein PGA1:2.264..2.264 Mbp (564 bp) score=10
PGA1_c21870 transcriptional regulator PGA1:2.27..2.27 Mbp (372 bp) score=10
PGA1_c21890 LysR family transcriptional regulator PGA1:2.272..2.272 Mbp (894 bp) score=10
PGA1_c21900 hypothetical protein PGA1:2.273..2.273 Mbp (216 bp) score=10
PGA1_c21910 hypothetical protein PGA1:2.273..2.273 Mbp (372 bp) score=10
PGA1_c21920 hypothetical protein PGA1:2.274..2.275 Mbp (777 bp) score=10
PGA1_c21930 acetyltransferase domain-containing protein PGA1:2.275..2.275 Mbp (474 bp) score=10
rpmG 50S ribosomal protein L33 PGA1:2.276..2.276 Mbp (168 bp) score=10
PGA1_c21960 hypothetical protein PGA1:2.277..2.278 Mbp (774 bp) score=10
PGA1_c22030 hypothetical protein PGA1:2.284..2.284 Mbp (918 bp) score=10
PGA1_c22040 toxic anion resistance protein PGA1:2.284..2.286 Mbp (1.197 kbp) score=10
PGA1_c22050 hypothetical protein PGA1:2.286..2.287 Mbp (885 bp) score=10
PGA1_c22060 hypothetical protein PGA1:2.287..2.288 Mbp (1.179 kbp) score=10
PGA1_c22070 hypothetical protein PGA1:2.288..2.289 Mbp (528 bp) score=10
PGA1_c22080 hypothetical protein PGA1:2.289..2.29 Mbp (1.152 kbp) score=10
PGA1_c22090 nitroreductase-like protein PGA1:2.29..2.29 Mbp (672 bp) score=10
gsiB2 glutathione-binding protein GsiB PGA1:2.291..2.293 Mbp (1.587 kbp) score=10
gsiD3 glutathione transport system permease protein GsiD PGA1:2.294..2.295 Mbp (816 bp) score=10
gsiA4 glutathione import ATP-binding protein GsiA PGA1:2.295..2.296 Mbp (1.638 kbp) score=10
PGA1_c22150 hypothetical protein PGA1:2.296..2.297 Mbp (837 bp) score=10
PGA1_c22160 hypothetical protein PGA1:2.297..2.298 Mbp (564 bp) score=10
PGA1_c22170 hypothetical protein PGA1:2.298..2.299 Mbp (927 bp) score=10
msbA1 lipid A export ATP-binding/permease protein MsbA PGA1:2.301..2.303 Mbp (1.8 kbp) score=10
PGA1_c22200 hypothetical protein PGA1:2.304..2.304 Mbp (693 bp) score=10
PGA1_c22210 hypothetical protein PGA1:2.305..2.305 Mbp (291 bp) score=10
PGA1_c22220 hypothetical protein PGA1:2.306..2.307 Mbp (612 bp) score=10
PGA1_c22230 hypothetical protein PGA1:2.307..2.311 Mbp (3.801 kbp) score=10
PGA1_c22240 hypothetical protein PGA1:2.312..2.312 Mbp (303 bp) score=10
PGA1_c22250 hypothetical protein PGA1:2.312..2.313 Mbp (666 bp) score=10
PGA1_c22260 hypothetical protein PGA1:2.313..2.313 Mbp (378 bp) score=10
PGA1_c22270 hypothetical protein PGA1:2.313..2.313 Mbp (345 bp) score=10
PGA1_c22280 hypothetical protein PGA1:2.313..2.314 Mbp (474 bp) score=10
PGA1_c22290 hypothetical protein PGA1:2.314..2.315 Mbp (726 bp) score=10
PGA1_c22300 hypothetical protein PGA1:2.315..2.315 Mbp (336 bp) score=10
PGA1_c22310 hypothetical protein PGA1:2.315..2.315 Mbp (423 bp) score=10
PGA1_c22320 hypothetical protein PGA1:2.315..2.316 Mbp (885 bp) score=10
PGA1_c22330 hypothetical protein PGA1:2.316..2.321 Mbp (4.569 kbp) score=10
PGA1_c22340 hypothetical protein PGA1:2.321..2.321 Mbp (312 bp) score=10
PGA1_c22350 hypothetical protein PGA1:2.321..2.322 Mbp (471 bp) score=10
PGA1_c22360 hypothetical protein PGA1:2.322..2.322 Mbp (447 bp) score=10
PGA1_c22370 hypothetical protein PGA1:2.322..2.323 Mbp (336 bp) score=10
PGA1_c22380 hypothetical protein PGA1:2.323..2.324 Mbp (456 bp) score=10
PGA1_c22390 hypothetical protein PGA1:2.324..2.324 Mbp (357 bp) score=10
PGA1_c22400 hypothetical protein PGA1:2.324..2.325 Mbp (606 bp) score=10
PGA1_c22410 major capsid protein PGA1:2.325..2.326 Mbp (1.203 kbp) score=10
PGA1_c22430 phage portal protein PGA1:2.327..2.328 Mbp (1.212 kbp) score=10
PGA1_c22450 hypothetical protein PGA1:2.33..2.33 Mbp (459 bp) score=10
PGA1_c22460 hypothetical protein PGA1:2.331..2.332 Mbp (756 bp) score=10
PGA1_c22470 hypothetical protein PGA1:2.332..2.332 Mbp (585 bp) score=10
PGA1_c22480 hypothetical protein PGA1:2.332..2.333 Mbp (768 bp) score=10
PGA1_c22490 hypothetical protein PGA1:2.333..2.334 Mbp (435 bp) score=10
PGA1_c22500 hypothetical protein PGA1:2.334..2.335 Mbp (261 bp) score=10
PGA1_c22510 hypothetical protein PGA1:2.335..2.335 Mbp (264 bp) score=10
PGA1_c22520 helix-turn-helix domain-containing protein PGA1:2.335..2.335 Mbp (324 bp) score=10
PGA1_c22530 hypothetical protein PGA1:2.336..2.336 Mbp (738 bp) score=10
PGA1_c22540 hypothetical protein PGA1:2.337..2.338 Mbp (270 bp) score=10
PGA1_c22550 DNA polymerase III beta subunit-like protein PGA1:2.338..2.339 Mbp (1.137 kbp) score=10
PGA1_c22560 hypothetical protein PGA1:2.339..2.34 Mbp (228 bp) score=10
PGA1_c22570 cytosine-specific DNA methylase domain-containing protein PGA1:2.34..2.341 Mbp (1.713 kbp) score=10
PGA1_c22580 phage integrase-like protein PGA1:2.342..2.343 Mbp (1.248 kbp) score=10
PGA1_c22610 transcriptional regulator, containing response regulator domain PGA1:2.344..2.345 Mbp (717 bp) score=10
PGA1_c22640 cbiX domain-containing protein PGA1:2.348..2.349 Mbp (750 bp) score=10
PGA1_c22660 phage integrase protein PGA1:2.35..2.351 Mbp (1.032 kbp) score=10
PGA1_c22670 hypothetical protein PGA1:2.351..2.351 Mbp (192 bp) score=10
PGA1_c22680 hypothetical protein PGA1:2.351..2.351 Mbp (195 bp) score=10
PGA1_c22690 helix-turn-helix domain-containing protein PGA1:2.351..2.351 Mbp (315 bp) score=10
PGA1_c22700 hypothetical protein PGA1:2.351..2.352 Mbp (642 bp) score=10
PGA1_c22720 AraC family transcriptional regulator PGA1:2.354..2.355 Mbp (1.02 kbp) score=10
PGA1_c22750 hypothetical protein PGA1:2.359..2.359 Mbp (687 bp) score=10
PGA1_c22770 LysR family transcriptional regulator PGA1:2.361..2.362 Mbp (924 bp) score=10
opuAA glycine betaine transport ATP-binding protein PGA1:2.362..2.363 Mbp (1.059 kbp) score=10
opuAC glycine betaine-binding protein PGA1:2.364..2.365 Mbp (972 bp) score=10
PGA1_c22810 hypothetical protein PGA1:2.366..2.366 Mbp (327 bp) score=10
PGA1_c22820 lytic transglycosylase-like protein PGA1:2.366..2.367 Mbp (579 bp) score=10
virB2 type IV secretion system protein VirB2 PGA1:2.367..2.367 Mbp (291 bp) score=10
PGA1_c22840 type IV secretory pathway virB3 protein PGA1:2.367..2.367 Mbp (279 bp) score=10
virB type IV secretion system protein VirB PGA1:2.367..2.37 Mbp (2.367 kbp) score=10
PGA1_c22860 hypothetical protein PGA1:2.37..2.37 Mbp (159 bp) score=10
PGA1_c22870 lytic transglycosylase-like protein PGA1:2.37..2.371 Mbp (1.149 kbp) score=10
PGA1_c22880 hypothetical protein PGA1:2.371..2.372 Mbp (780 bp) score=10
virB8 type IV secretion system protein VirB8 PGA1:2.372..2.372 Mbp (651 bp) score=10
virB9 type IV secretion system protein VirB9 PGA1:2.372..2.373 Mbp (696 bp) score=10
virB10 type IV secretion system protein VirB10 PGA1:2.373..2.374 Mbp (1.314 kbp) score=10
virB11 type IV secretion system protein VirB11 PGA1:2.374..2.375 Mbp (996 bp) score=10
PGA1_c22930 hypothetical protein PGA1:2.375..2.376 Mbp (177 bp) score=10
virB6 type IV secretion system protein VirB6 PGA1:2.376..2.377 Mbp (999 bp) score=10
PGA1_c22950 hypothetical protein PGA1:2.377..2.379 Mbp (1.764 kbp) score=10
PGA1_c22960 hypothetical protein PGA1:2.379..2.38 Mbp (1.245 kbp) score=10
virD4 protein VirD4 PGA1:2.381..2.383 Mbp (1.893 kbp) score=10
virD2 protein VirD2 PGA1:2.383..2.385 Mbp (1.809 kbp) score=10
PGA1_c22990 hypothetical protein PGA1:2.385..2.385 Mbp (591 bp) score=10
PGA1_c23000 hypothetical protein PGA1:2.386..2.386 Mbp (282 bp) score=10
PGA1_c23010 hypothetical protein PGA1:2.386..2.386 Mbp (225 bp) score=10
PGA1_c23020 hypothetical protein PGA1:2.386..2.386 Mbp (204 bp) score=10
PGA1_c23030 ArdC antirestriction protein PGA1:2.386..2.387 Mbp (879 bp) score=10
PGA1_c23040 hypothetical protein PGA1:2.388..2.389 Mbp (705 bp) score=10
rbsA2 ribose import ATP-binding protein RbsA PGA1:2.389..2.391 Mbp (1.512 kbp) score=10
PGA1_c23070 ribose transport system permease protein PGA1:2.391..2.392 Mbp (1.002 kbp) score=10
PGA1_c23100 D-ribose-binding periplasmic protein PGA1:2.394..2.395 Mbp (957 bp) score=10
PGA1_c23110 sugar ABC transporter, extracellular solute-binding protein PGA1:2.395..2.397 Mbp (1.845 kbp) score=10
PGA1_c23180 dihydrolipoyllysine-residue acetyltransferase-like protein PGA1:2.404..2.405 Mbp (879 bp) score=10
PGA1_c23210 hypothetical protein PGA1:2.408..2.408 Mbp (393 bp) score=10
hipA protein HipA PGA1:2.408..2.41 Mbp (1.293 kbp) score=10
PGA1_c23230 hypothetical protein PGA1:2.41..2.411 Mbp (864 bp) score=10
PGA1_c23250 DeoR family transcriptional regulator PGA1:2.413..2.414 Mbp (837 bp) score=10
PGA1_c23260 glycine betaine transport system, substrate binding protein PGA1:2.414..2.415 Mbp (948 bp) score=10
PGA1_c23270 amino acid transport sytem, ATP-binding protein PGA1:2.415..2.416 Mbp (1.035 kbp) score=10
PGA1_c23280 amino acid transport sytem, permease protein PGA1:2.416..2.418 Mbp (1.995 kbp) score=10
PGA1_c23310 AraC family transcriptional regulator PGA1:2.422..2.423 Mbp (1.05 kbp) score=10
PGA1_c23320 inositol monophosphatase-like protein PGA1:2.423..2.423 Mbp (801 bp) score=10
PGA1_c23370 hypothetical protein PGA1:2.428..2.429 Mbp (141 bp) score=10
PGA1_c23380 choline/ethanolamine kinase-like protein PGA1:2.429..2.43 Mbp (927 bp) score=10
PGA1_c23400 DeoR family transcriptional regulator PGA1:2.433..2.433 Mbp (792 bp) score=10
PGA1_c23410 hypothetical protein PGA1:2.434..2.434 Mbp (783 bp) score=10
PGA1_c23420 hypothetical protein PGA1:2.435..2.438 Mbp (3.321 kbp) score=10
PGA1_c23430 hypothetical protein PGA1:2.438..2.439 Mbp (1.122 kbp) score=10
PGA1_c23470 MarR family transcriptional regulator PGA1:2.443..2.443 Mbp (459 bp) score=10
ptsP phosphoenolpyruvate-protein phosphotransferase PtsP PGA1:2.447..2.449 Mbp (2.241 kbp) score=10
PGA1_c23520 trk system potassium uptake protein PGA1:2.451..2.452 Mbp (1.449 kbp) score=10
PGA1_c23525 hypothetical protein PGA1:2.452..2.453 Mbp (759 bp) score=10
PGA1_c23530 hypothetical protein PGA1:2.453..2.454 Mbp (1.104 kbp) score=10
PGA1_c23550 intracellular septation protein PGA1:2.456..2.457 Mbp (615 bp) score=10
PGA1_c23560 hypothetical protein PGA1:2.457..2.458 Mbp (903 bp) score=10
PGA1_c23570 cell division protein PGA1:2.458..2.459 Mbp (1.248 kbp) score=10
PGA1_c23580 hypothetical protein PGA1:2.459..2.46 Mbp (678 bp) score=10
PGA1_c23590 hypothetical protein PGA1:2.46..2.46 Mbp (414 bp) score=10
PGA1_c23620 hypothetical protein PGA1:2.464..2.465 Mbp (882 bp) score=10
PGA1_c23630 transcriptional regulator PGA1:2.465..2.466 Mbp (633 bp) score=10
PGA1_c23640 hypothetical protein PGA1:2.466..2.468 Mbp (1.776 kbp) score=10
PGA1_c23650 hypothetical protein PGA1:2.468..2.469 Mbp (864 bp) score=10
PGA1_c23670 hypothetical protein PGA1:2.47..2.47 Mbp (585 bp) score=10
PGA1_c23680 CRP family transcriptional regulator PGA1:2.47..2.471 Mbp (762 bp) score=10
hflC protein HflC PGA1:2.473..2.474 Mbp (891 bp) score=10
hflK protein HflK PGA1:2.474..2.475 Mbp (1.155 kbp) score=10
PGA1_c23730 hypothetical protein PGA1:2.477..2.477 Mbp (471 bp) score=10
PGA1_c23750 hypothetical protein PGA1:2.478..2.479 Mbp (312 bp) score=10
PGA1_c23780 hypothetical protein PGA1:2.481..2.482 Mbp (963 bp) score=10
PGA1_c23790 thiamine pyrophosphokinase-like protein PGA1:2.482..2.483 Mbp (666 bp) score=10
PGA1_c23800 hypothetical protein PGA1:2.483..2.485 Mbp (2.271 kbp) score=10
PGA1_c23810 hypothetical protein PGA1:2.485..2.486 Mbp (246 bp) score=10
PGA1_c23860 hypothetical protein PGA1:2.491..2.491 Mbp (357 bp) score=10
PGA1_c23920 enoyl-CoA hydratase/isomerase-like protein PGA1:2.496..2.497 Mbp (786 bp) score=10
msbA2 lipid A export ATP-binding/permease protein MsbA PGA1:2.5..2.502 Mbp (2.01 kbp) score=10
PGA1_c23970 hypothetical protein PGA1:2.503..2.503 Mbp (570 bp) score=10
PGA1_c23990 hypothetical protein PGA1:2.504..2.505 Mbp (318 bp) score=10
PGA1_c24010 hypothetical protein PGA1:2.506..2.508 Mbp (1.41 kbp) score=10
PGA1_c24020 outer membrane efflux protein PGA1:2.508..2.509 Mbp (1.419 kbp) score=10
PGA1_c24030 protein-L-isoaspartate O-methyltransferase PGA1:2.509..2.51 Mbp (654 bp) score=10
PGA1_c24040 hypothetical protein PGA1:2.51..2.511 Mbp (516 bp) score=10
PGA1_c24050 hypothetical protein PGA1:2.511..2.511 Mbp (309 bp) score=10
PGA1_c24060 hypothetical protein PGA1:2.511..2.512 Mbp (288 bp) score=10
PGA1_c24070 hypothetical protein PGA1:2.512..2.512 Mbp (240 bp) score=10
PGA1_c24080 hypothetical protein PGA1:2.512..2.513 Mbp (834 bp) score=10
lepA GTP-binding protein LepA PGA1:2.513..2.515 Mbp (1.815 kbp) score=10
PGA1_c24100 hypothetical protein PGA1:2.515..2.517 Mbp (1.431 kbp) score=10
PGA1_c24110 hypothetical protein PGA1:2.517..2.517 Mbp (183 bp) score=10
PGA1_c24120 hypothetical protein PGA1:2.517..2.518 Mbp (312 bp) score=10
PGA1_c24130 LysR family transcriptional regulator PGA1:2.518..2.519 Mbp (978 bp) score=10
PGA1_c24140 protein-tyrosine phosphatase PGA1:2.519..2.519 Mbp (441 bp) score=10
PGA1_c24150 hypothetical protein PGA1:2.52..2.52 Mbp (471 bp) score=10
PGA1_c24160 hypothetical protein PGA1:2.52..2.52 Mbp (426 bp) score=10
rpmB 50S ribosomal protein L28 PGA1:2.521..2.521 Mbp (291 bp) score=10
PGA1_c24270 hypothetical protein PGA1:2.533..2.533 Mbp (519 bp) score=10
yghU GST-like protein YghU PGA1:2.533..2.534 Mbp (882 bp) score=10
PGA1_c24290 hypothetical protein PGA1:2.534..2.535 Mbp (798 bp) score=10
PGA1_c24300 hypothetical protein PGA1:2.535..2.536 Mbp (594 bp) score=10
PGA1_c24310 capsular polysaccharide transport system, ATP-binding protein PGA1:2.536..2.537 Mbp (660 bp) score=10
PGA1_c24320 capsule polysaccharide export inner-membrane protein PGA1:2.537..2.539 Mbp (1.707 kbp) score=10
PGA1_c24350 hypothetical protein PGA1:2.541..2.543 Mbp (1.953 kbp) score=10
PGA1_c24360 hypothetical protein PGA1:2.543..2.543 Mbp (393 bp) score=10
rimO ribosomal protein S12 methylthiotransferase RimO PGA1:2.544..2.545 Mbp (1.422 kbp) score=10
PGA1_c24380 hypothetical protein PGA1:2.545..2.546 Mbp (618 bp) score=10
PGA1_c24390 hypothetical protein PGA1:2.546..2.547 Mbp (390 bp) score=10
PGA1_c24400 hypothetical protein PGA1:2.547..2.547 Mbp (267 bp) score=10
PGA1_c24410 hypothetical protein PGA1:2.547..2.547 Mbp (282 bp) score=10
PGA1_c24420 hypothetical protein PGA1:2.547..2.548 Mbp (339 bp) score=10
PGA1_c24430 peptidase M48-like protein PGA1:2.548..2.549 Mbp (726 bp) score=10
PGA1_c24440 hypothetical protein PGA1:2.549..2.549 Mbp (249 bp) score=10
PGA1_c24450 hypothetical protein PGA1:2.549..2.549 Mbp (297 bp) score=10
PGA1_c24470 hypothetical protein PGA1:2.55..2.551 Mbp (705 bp) score=10
PGA1_c24480 hypothetical protein PGA1:2.551..2.551 Mbp (276 bp) score=10
PGA1_c24510 hypothetical protein PGA1:2.553..2.554 Mbp (1.224 kbp) score=10
PGA1_c24520 hypothetical protein PGA1:2.554..2.556 Mbp (1.398 kbp) score=10
PGA1_c24570 LysR type HTH-type transcriptional regulator PGA1:2.563..2.564 Mbp (882 bp) score=10
PGA1_c24590 trypsin-like protein PGA1:2.566..2.566 Mbp (714 bp) score=10
PGA1_c24610 integral membrane protein, AcrB/AcrD/AcrF family PGA1:2.567..2.57 Mbp (3.045 kbp) score=10
PGA1_c24620 secretion protein PGA1:2.57..2.571 Mbp (1.044 kbp) score=10
PGA1_c24630 MarR family transcriptional regulator PGA1:2.571..2.571 Mbp (498 bp) score=10
PGA1_c24640 3-oxoacyl-[acyl-carrier-protein] synthase 3 PGA1:2.572..2.573 Mbp (1.125 kbp) score=10
PGA1_c24660 hypothetical protein PGA1:2.574..2.574 Mbp (462 bp) score=10
PGA1_c24710 hypothetical protein PGA1:2.577..2.578 Mbp (501 bp) score=10
PGA1_c24720 hypothetical protein PGA1:2.578..2.578 Mbp (249 bp) score=10
lgt prolipoprotein diacylglyceryl transferase Lgt PGA1:2.579..2.579 Mbp (903 bp) score=10
PGA1_c24740 hypothetical protein PGA1:2.579..2.58 Mbp (1.068 kbp) score=10
PGA1_c24750 hypothetical protein PGA1:2.58..2.581 Mbp (768 bp) score=10
PGA1_c24760 hypothetical protein PGA1:2.582..2.583 Mbp (777 bp) score=10
PGA1_c24770 leucine-responsive regulatory protein PGA1:2.583..2.583 Mbp (501 bp) score=10
PGA1_c24790 hypothetical protein PGA1:2.584..2.585 Mbp (336 bp) score=10
PGA1_c24810 hypothetical protein PGA1:2.587..2.588 Mbp (870 bp) score=10
PGA1_c24820 phenazine biosynthesis protein PGA1:2.588..2.589 Mbp (882 bp) score=10
PGA1_c24830 hypothetical protein PGA1:2.589..2.589 Mbp (225 bp) score=10
ibpA1 small heat shock protein IbpA PGA1:2.589..2.59 Mbp (414 bp) score=10
PGA1_c24850 hypothetical protein PGA1:2.59..2.59 Mbp (225 bp) score=10
PGA1_c24880 hypothetical protein PGA1:2.592..2.593 Mbp (1.149 kbp) score=10
PGA1_c24890 hypothetical protein PGA1:2.593..2.594 Mbp (819 bp) score=10
PGA1_c24900 hypothetical protein PGA1:2.594..2.595 Mbp (882 bp) score=10
PGA1_c24910 hypothetical protein PGA1:2.595..2.596 Mbp (603 bp) score=10
PGA1_c24940 hypothetical protein PGA1:2.598..2.599 Mbp (711 bp) score=10
PGA1_c24960 methyl-accepting chemotaxis protein PGA1:2.6..2.602 Mbp (1.959 kbp) score=10
PGA1_c24980 maoC like domain-containing protein PGA1:2.603..2.604 Mbp (444 bp) score=10
ribF riboflavin biosynthesis protein RibF PGA1:2.604..2.605 Mbp (933 bp) score=10
PGA1_c25000 hypothetical protein PGA1:2.605..2.605 Mbp (471 bp) score=10
PGA1_c25020 LysR family transcriptional regulator PGA1:2.606..2.607 Mbp (876 bp) score=10
PGA1_c25030 hypothetical protein PGA1:2.607..2.608 Mbp (435 bp) score=10
PGA1_c25040 alpha/beta hydrolase domain-containing protein PGA1:2.608..2.609 Mbp (858 bp) score=10
PGA1_c25070 hypothetical protein PGA1:2.61..2.611 Mbp (351 bp) score=10
PGA1_c25130 hypothetical protein PGA1:2.616..2.617 Mbp (747 bp) score=10
PGA1_c25170 hypothetical protein PGA1:2.622..2.622 Mbp (585 bp) score=10
PGA1_c25180 hypothetical protein PGA1:2.622..2.624 Mbp (1.968 kbp) score=10
PGA1_c25190 hypothetical protein PGA1:2.624..2.625 Mbp (1.182 kbp) score=10
chaC cation transport protein ChaC PGA1:2.625..2.626 Mbp (531 bp) score=10
PGA1_c25210 hypothetical protein PGA1:2.626..2.627 Mbp (1.005 kbp) score=10
PGA1_c25220 extensin-like protein PGA1:2.627..2.628 Mbp (864 bp) score=10
tyrC protein TyrC PGA1:2.628..2.629 Mbp (921 bp) score=10
PGA1_c25250 AsnC family transcriptional regulator PGA1:2.63..2.63 Mbp (462 bp) score=10
PGA1_c25260 hypothetical protein PGA1:2.631..2.631 Mbp (576 bp) score=10
rpsD 30S ribosomal protein S4 PGA1:2.631..2.632 Mbp (621 bp) score=10
PGA1_c25290 hypothetical protein PGA1:2.632..2.633 Mbp (1.077 kbp) score=10
PGA1_c25320 hypothetical protein PGA1:2.637..2.638 Mbp (1.518 kbp) score=10
PGA1_c25340 sodium bile acid symporter-like protein PGA1:2.64..2.641 Mbp (867 bp) score=10
PGA1_c25350 TetR family transcriptional regulator PGA1:2.641..2.642 Mbp (612 bp) score=10
PGA1_c25360 fumarylacetoacetate hydrolase-like protein PGA1:2.642..2.643 Mbp (1.206 kbp) score=10
PGA1_c25390 ATP-binding protein PGA1:2.645..2.646 Mbp (708 bp) score=10
PGA1_c25410 LysR family transcriptional regulator PGA1:2.647..2.648 Mbp (915 bp) score=10
PGA1_c25450 transport system, extracellular solute binding protein PGA1:2.649..2.651 Mbp (1.668 kbp) score=10
PGA1_c25530 AraC family transcriptional regulator PGA1:2.658..2.659 Mbp (1.086 kbp) score=10
PGA1_c25560 LysR family transcriptional regulator PGA1:2.663..2.664 Mbp (975 bp) score=10
PGA1_c25570 glycine betaine transport system, substrate binding protein PGA1:2.664..2.665 Mbp (963 bp) score=10
PGA1_c25580 glycine betaine/L-proline transport system permease protein PGA1:2.665..2.666 Mbp (1.032 kbp) score=10
PGA1_c25610 hypothetical protein PGA1:2.668..2.668 Mbp (567 bp) score=10
PGA1_c25620 hypothetical protein PGA1:2.668..2.669 Mbp (447 bp) score=10
PGA1_c25630 hypothetical protein PGA1:2.669..2.669 Mbp (213 bp) score=10
PGA1_c25720 LysR family transcriptional regulator PGA1:2.679..2.68 Mbp (873 bp) score=10
PGA1_c25730 hypothetical protein PGA1:2.68..2.681 Mbp (282 bp) score=10
PGA1_c25760 LysR family transcriptional regulator PGA1:2.685..2.686 Mbp (978 bp) score=10
PGA1_c25770 hypothetical protein PGA1:2.687..2.687 Mbp (546 bp) score=10
PGA1_c25780 methyl-accepting chemotaxis protein PGA1:2.688..2.69 Mbp (1.866 kbp) score=10
PGA1_c25800 hypothetical protein PGA1:2.69..2.692 Mbp (1.224 kbp) score=10
PGA1_c25810 ABC transporter ATP-binding protein PGA1:2.692..2.693 Mbp (1.518 kbp) score=10
PGA1_c25840 phase integrase-like protein PGA1:2.694..2.695 Mbp (1.113 kbp) score=10
PGA1_c25850 hypothetical protein PGA1:2.695..2.696 Mbp (201 bp) score=10
PGA1_c25860 phage portal protein, HK97 family PGA1:2.696..2.697 Mbp (1.218 kbp) score=10
PGA1_c25880 DNA packaging phage protein PGA1:2.697..2.698 Mbp (282 bp) score=10
PGA1_c25890 iron ABC transport system, periplasmic binding protein PGA1:2.698..2.699 Mbp (1.083 kbp) score=10
PGA1_c25900 iron ABC transport system, permease protein PGA1:2.699..2.7 Mbp (1.032 kbp) score=10
fepC ferric enterobactin transport ATP-binding protein FepC PGA1:2.701..2.702 Mbp (783 bp) score=10
PGA1_c25930 siderophore interacting protein PGA1:2.702..2.703 Mbp (1.053 kbp) score=10
PGA1_c25940 hypothetical protein PGA1:2.703..2.704 Mbp (1.011 kbp) score=10
PGA1_c25950 biopolymer transport protein PGA1:2.704..2.705 Mbp (378 bp) score=10
PGA1_c25960 biopolymer transport protein PGA1:2.705..2.705 Mbp (378 bp) score=10
PGA1_c25970 tonB-like protein PGA1:2.705..2.706 Mbp (864 bp) score=10
PGA1_c25990 hypothetical protein PGA1:2.709..2.709 Mbp (222 bp) score=10
PGA1_c26010 MarR family transcriptional regulator PGA1:2.71..2.71 Mbp (441 bp) score=10
PGA1_c26020 MarR family transcriptional regulator PGA1:2.71..2.711 Mbp (303 bp) score=10
PGA1_c26030 MarR family transcriptional regulator PGA1:2.711..2.711 Mbp (135 bp) score=10
PGA1_c26040 hypothetical protein PGA1:2.711..2.711 Mbp (498 bp) score=10
PGA1_c26060 hypothetical protein PGA1:2.712..2.712 Mbp (447 bp) score=10
PGA1_c26070 antibiotic biosynthesis monooxygenase-like protein PGA1:2.713..2.713 Mbp (369 bp) score=10
PGA1_c26080 hypothetical protein PGA1:2.713..2.714 Mbp (930 bp) score=10
PGA1_c26090 hypothetical protein PGA1:2.714..2.715 Mbp (759 bp) score=10
PGA1_c26100 hypothetical protein PGA1:2.715..2.716 Mbp (981 bp) score=10
PGA1_c26110 antibiotic biosynthesis monooxygenase-like protein PGA1:2.716..2.717 Mbp (324 bp) score=10
PGA1_c26120 hypothetical protein PGA1:2.717..2.718 Mbp (1.542 kbp) score=10
PGA1_c26130 hypothetical protein PGA1:2.719..2.719 Mbp (399 bp) score=10
PGA1_c26140 hypothetical protein PGA1:2.719..2.722 Mbp (3.339 kbp) score=10
uvrB uvrABC system protein B PGA1:2.723..2.726 Mbp (2.199 kbp) score=10
PGA1_c26170 hypothetical protein PGA1:2.726..2.726 Mbp (306 bp) score=10
PGA1_c26180 hypothetical protein PGA1:2.727..2.727 Mbp (258 bp) score=10
PGA1_c26190 universal stress protein PGA1:2.727..2.727 Mbp (408 bp) score=10
PGA1_c26200 antibiotic biosynthesis monooxygenase-like protein PGA1:2.727..2.728 Mbp (318 bp) score=10
PGA1_c26210 hypothetical protein PGA1:2.728..2.729 Mbp (648 bp) score=10
PGA1_c26220 hypothetical protein PGA1:2.729..2.731 Mbp (2.286 kbp) score=10
PGA1_c26230 hypothetical protein PGA1:2.731..2.732 Mbp (414 bp) score=10
PGA1_c26250 hypothetical protein PGA1:2.734..2.734 Mbp (423 bp) score=10
PGA1_c26280 hypothetical protein PGA1:2.736..2.737 Mbp (849 bp) score=10
PGA1_c26300 ABC transporter ATP-binding protein PGA1:2.738..2.74 Mbp (1.668 kbp) score=10
PGA1_c26310 hypothetical protein PGA1:2.741..2.741 Mbp (252 bp) score=10
PGA1_c26320 hypothetical protein PGA1:2.742..2.742 Mbp (168 bp) score=10
PGA1_c26340 hypothetical protein PGA1:2.743..2.744 Mbp (1.242 kbp) score=10
PGA1_c26350 hypothetical protein PGA1:2.745..2.745 Mbp (552 bp) score=10
PGA1_c26360 cold shock protein PGA1:2.745..2.746 Mbp (207 bp) score=10
PGA1_c26380 ABC transporter ATP-binding protein PGA1:2.746..2.747 Mbp (717 bp) score=10
PGA1_c26400 HTH-type transcriptional regulator PGA1:2.75..2.75 Mbp (465 bp) score=10
PGA1_c26410 hypothetical protein PGA1:2.75..2.751 Mbp (588 bp) score=10
PGA1_c26420 hypothetical protein PGA1:2.751..2.752 Mbp (1.188 kbp) score=10
PGA1_c26460 hypothetical protein PGA1:2.757..2.759 Mbp (1.533 kbp) score=10
PGA1_c26480 hypothetical protein PGA1:2.761..2.762 Mbp (801 bp) score=10
mreB rod shape-determining protein MreB PGA1:2.763..2.764 Mbp (1.047 kbp) score=10
mreC rod shape-determining protein MreC PGA1:2.764..2.765 Mbp (936 bp) score=10
PGA1_c26520 hypothetical protein PGA1:2.765..2.766 Mbp (537 bp) score=10
mrdA penicillin-binding protein 2 PGA1:2.766..2.768 Mbp (1.947 kbp) score=10
mrdB rod shape-determining protein RodA PGA1:2.768..2.769 Mbp (1.14 kbp) score=10
PGA1_c26550 LysR family transcriptional regulator PGA1:2.769..2.77 Mbp (858 bp) score=10
PGA1_c26560 hypothetical protein PGA1:2.77..2.77 Mbp (411 bp) score=10
PGA1_c26610 amino acid ABC transporter substrate-binding protein PGA1:2.777..2.777 Mbp (813 bp) score=10
moeB molybdopterin biosynthesis protein MoeB PGA1:2.777..2.779 Mbp (1.137 kbp) score=10
coaBC coenzyme A biosynthesis bifunctional protein CoaBC PGA1:2.779..2.78 Mbp (1.203 kbp) score=10
PGA1_c26650 hypothetical protein PGA1:2.78..2.781 Mbp (948 bp) score=10
cobP bifunctional adenosylcobalamin biosynthesis protein CobP PGA1:2.782..2.783 Mbp (519 bp) score=10
PGA1_c26680 phosphoglycerate mutase family protein PGA1:2.783..2.784 Mbp (606 bp) score=10
PGA1_c26690 hypothetical protein PGA1:2.784..2.784 Mbp (684 bp) score=10
PGA1_c26720 hypothetical protein PGA1:2.787..2.787 Mbp (405 bp) score=10
PGA1_c26730 hypothetical protein PGA1:2.787..2.788 Mbp (861 bp) score=10
PGA1_c26740 hypothetical protein PGA1:2.788..2.789 Mbp (1.245 kbp) score=10
PGA1_c26765 peptidase S54-like protein PGA1:2.794..2.795 Mbp (687 bp) score=10
cspA2 cold shock protein CspA PGA1:2.796..2.796 Mbp (207 bp) score=10
PGA1_c26790 TetR family transcriptional regulator PGA1:2.796..2.797 Mbp (597 bp) score=10
paaI phenylacetic acid degradation protein PaaI PGA1:2.798..2.799 Mbp (426 bp) score=10
paaZ phenylacetic acid degradation protein PaaZ PGA1:2.799..2.801 Mbp (2.031 kbp) score=10
paaZ phenylacetic acid degradation protein PaaZ PGA1:2.799..2.801 Mbp (2.031 kbp) score=10
PGA1_c26840 phenylacetic acid degradation operon negative regulatory protein PGA1:2.802..2.802 Mbp (825 bp) score=10
PGA1_c26850 hypothetical protein PGA1:2.803..2.803 Mbp (426 bp) score=10
PGA1_c26860 iron transport system, ATP-binding protein PGA1:2.803..2.804 Mbp (786 bp) score=10
PGA1_c26870 periplasmic binding protein PGA1:2.804..2.805 Mbp (981 bp) score=10
PGA1_c26880 iron transport system permease protein PGA1:2.805..2.806 Mbp (1.08 kbp) score=10
PGA1_c26900 lipoprotein PGA1:2.807..2.808 Mbp (1.032 kbp) score=10
PGA1_c26910 ABC transporter ATP-binding protein PGA1:2.808..2.809 Mbp (1.569 kbp) score=10
exoD exopolysaccharide synthesis protein ExoD PGA1:2.813..2.813 Mbp (582 bp) score=10
PGA1_c26970 mechanosensitive ion channel-like protein PGA1:2.814..2.815 Mbp (1.464 kbp) score=10
PGA1_c26980 hypothetical protein PGA1:2.815..2.816 Mbp (264 bp) score=10
PGA1_c26990 hypothetical protein PGA1:2.816..2.817 Mbp (510 bp) score=10
PGA1_c27000 hypothetical protein PGA1:2.817..2.817 Mbp (198 bp) score=10
PGA1_c27010 hypothetical protein PGA1:2.817..2.818 Mbp (555 bp) score=10
PGA1_c27020 hypothetical protein PGA1:2.818..2.818 Mbp (411 bp) score=10
PGA1_c27030 hypothetical protein PGA1:2.818..2.819 Mbp (735 bp) score=10
PGA1_c27040 hypothetical protein PGA1:2.819..2.82 Mbp (1.023 kbp) score=10
PGA1_c27080 response regulator receiver protein PGA1:2.824..2.825 Mbp (816 bp) score=10
PGA1_c27110 hypothetical protein PGA1:2.826..2.826 Mbp (165 bp) score=10
PGA1_c27120 hypothetical protein PGA1:2.826..2.826 Mbp (315 bp) score=10
PGA1_c27130 HTH-type transcriptional regulator PGA1:2.826..2.827 Mbp (873 bp) score=10
PGA1_c27210 metal dependent phosphohydrolases-like protein PGA1:2.836..2.836 Mbp (618 bp) score=10
PGA1_c27230 LysR family transcriptional regulator PGA1:2.838..2.838 Mbp (858 bp) score=10
PGA1_c27240 hypothetical protein PGA1:2.839..2.839 Mbp (372 bp) score=10
PGA1_c27260 hypothetical protein PGA1:2.84..2.841 Mbp (720 bp) score=10
PGA1_c27270 extracellular solute-binding protein PGA1:2.841..2.842 Mbp (1.398 kbp) score=10
PGA1_c27310 hypothetical protein PGA1:2.846..2.847 Mbp (1.002 kbp) score=10
PGA1_c27320 sugar ABC transporter ATP-binding protein PGA1:2.847..2.848 Mbp (1.05 kbp) score=10
PGA1_c27330 extracellular solute-binding protein PGA1:2.848..2.849 Mbp (1.227 kbp) score=10
PGA1_c27360 polyketide cyclase-like protein PGA1:2.851..2.852 Mbp (537 bp) score=10
PGA1_c27380 hypothetical protein PGA1:2.853..2.854 Mbp (963 bp) score=10
PGA1_c27400 LacL family transcriptional regulator PGA1:2.855..2.856 Mbp (1.029 kbp) score=10
PGA1_c27410 hypothetical protein PGA1:2.856..2.857 Mbp (990 bp) score=10
PGA1_c27420 hypothetical protein PGA1:2.857..2.858 Mbp (963 bp) score=10
PGA1_c27430 2-hydroxypropyl-CoM lyase-like protein PGA1:2.858..2.859 Mbp (1.128 kbp) score=10
PGA1_c27440 alpha/beta hydrolase domain-containing protein PGA1:2.859..2.86 Mbp (666 bp) score=10
PGA1_c27450 hypothetical protein PGA1:2.86..2.861 Mbp (696 bp) score=10
PGA1_c27460 methyl-accepting chemotaxis protein PGA1:2.861..2.862 Mbp (1.131 kbp) score=10
PGA1_c27470 methyl-accepting chemotaxis protein PGA1:2.862..2.863 Mbp (939 bp) score=10
PGA1_c27480 nitrate- and nitrite sensing domain-containing protein PGA1:2.863..2.864 Mbp (978 bp) score=10
PGA1_c27520 amine oxidoreductase-like protein PGA1:2.867..2.868 Mbp (1.29 kbp) score=10
PGA1_c27530 hypothetical protein PGA1:2.868..2.869 Mbp (753 bp) score=10
PGA1_c27550 hypothetical protein PGA1:2.87..2.871 Mbp (564 bp) score=10
PGA1_c27570 hypothetical protein PGA1:2.872..2.873 Mbp (546 bp) score=10
PGA1_c27590 saccharopine dehydrogenase-like protein PGA1:2.873..2.874 Mbp (726 bp) score=10
PGA1_c27620 cytochrome c-like protein PGA1:2.878..2.879 Mbp (1.323 kbp) score=10
PGA1_c27660 hypothetical protein PGA1:2.884..2.884 Mbp (192 bp) score=10
PGA1_c27680 hypothetical protein PGA1:2.885..2.886 Mbp (711 bp) score=10
PGA1_c27690 hypothetical protein PGA1:2.886..2.886 Mbp (576 bp) score=10
PGA1_c27700 hypothetical protein PGA1:2.887..2.889 Mbp (1.95 kbp) score=10
PGA1_c27710 hypothetical protein PGA1:2.889..2.889 Mbp (735 bp) score=10
PGA1_c27720 hypothetical protein PGA1:2.89..2.891 Mbp (1.065 kbp) score=10
PGA1_c27730 hypothetical protein PGA1:2.891..2.891 Mbp (708 bp) score=10
PGA1_c27740 hypothetical protein PGA1:2.891..2.892 Mbp (477 bp) score=10
PGA1_c27750 hypothetical protein PGA1:2.892..2.893 Mbp (804 bp) score=10
PGA1_c27760 ABC transporter ATP-binding protein PGA1:2.893..2.893 Mbp (726 bp) score=10
PGA1_c27820 hypothetical protein PGA1:2.898..2.9 Mbp (1.461 kbp) score=10
PGA1_c27830 hypothetical protein PGA1:2.9..2.9 Mbp (786 bp) score=10
PGA1_c27840 polysaccharide biosynthesis protein PGA1:2.9..2.901 Mbp (402 bp) score=10
PGA1_c27890 hexosephosphate binding protein PGA1:2.907..2.908 Mbp (1.029 kbp) score=10
PGA1_c27900 ligand-binding UTRA domain-containing protein PGA1:2.908..2.909 Mbp (759 bp) score=10
PGA1_c27930 sugar ABC transporter, periplasmic binding protein PGA1:2.911..2.912 Mbp (1.254 kbp) score=10
smoK ATP-binding transport protein SmoK PGA1:2.915..2.916 Mbp (996 bp) score=10
PGA1_c28030 hypothetical protein PGA1:2.924..2.924 Mbp (645 bp) score=10
PGA1_c28040 ABC transporter ATP-binding protein PGA1:2.924..2.925 Mbp (777 bp) score=10
PGA1_c28060 sugar transport system, periplasmic protein PGA1:2.926..2.927 Mbp (1.017 kbp) score=10
PGA1_c28070 MarR family transcriptional regulator PGA1:2.928..2.929 Mbp (1.203 kbp) score=10
PGA1_c28130 ABC transporter ATP-binding protein PGA1:2.938..2.94 Mbp (1.518 kbp) score=10
PGA1_c28150 hypothetical protein PGA1:2.941..2.941 Mbp (315 bp) score=10
PGA1_c28170 basic membrane lipoprotein PGA1:2.942..2.943 Mbp (1.077 kbp) score=10
PGA1_c28210 hypothetical protein PGA1:2.946..2.947 Mbp (672 bp) score=10
PGA1_c28220 hypothetical protein PGA1:2.947..2.948 Mbp (705 bp) score=10
PGA1_c28270 hypothetical protein PGA1:2.956..2.956 Mbp (534 bp) score=10
PGA1_c28280 hypothetical protein PGA1:2.956..2.959 Mbp (2.631 kbp) score=10
PGA1_c28290 phosphoesterase-like protein PGA1:2.959..2.96 Mbp (1.134 kbp) score=10
PGA1_c28300 GntR family transcriptional regulator PGA1:2.96..2.961 Mbp (681 bp) score=10
PGA1_c28310 hypothetical protein PGA1:2.961..2.962 Mbp (1.02 kbp) score=10
PGA1_c28320 ABC transporter ATP-binding protein PGA1:2.962..2.963 Mbp (768 bp) score=10
PGA1_c28360 hypothetical protein PGA1:2.967..2.968 Mbp (1.035 kbp) score=10
PGA1_c28370 homoserine/homoserine lactone efflux protein PGA1:2.968..2.969 Mbp (639 bp) score=10
PGA1_c28380 hypothetical protein PGA1:2.969..2.97 Mbp (471 bp) score=10
PGA1_c28390 hypothetical protein PGA1:2.97..2.97 Mbp (540 bp) score=10
PGA1_c28400 ABC transporter ATP-binding protein PGA1:2.97..2.971 Mbp (747 bp) score=10
PGA1_c28410 ABC transporter ATP-binding protein PGA1:2.971..2.972 Mbp (849 bp) score=10
PGA1_c28420 D,D-dipeptide transport system permease protein PGA1:2.972..2.973 Mbp (903 bp) score=10
PGA1_c28430 D,D-dipeptide transport system permease protein PGA1:2.973..2.974 Mbp (1.158 kbp) score=10
PGA1_c28440 transcriptional regulator PGA1:2.974..2.975 Mbp (618 bp) score=10
PGA1_c28530 hypothetical protein PGA1:2.989..2.99 Mbp (1.017 kbp) score=10
PGA1_c28540 dTDP-D-glucose 4,6-dehydratase-like protein PGA1:2.991..2.992 Mbp (1.086 kbp) score=10
PGA1_c28560 hypothetical protein PGA1:2.994..2.994 Mbp (327 bp) score=10
PGA1_c28570 hypothetical protein PGA1:2.994..2.994 Mbp (405 bp) score=10
PGA1_c28670 hypothetical protein PGA1:3.002..3.003 Mbp (756 bp) score=10
PGA1_c28690 vanillate O-demthylase oxidoreductase-like protein PGA1:3.005..3.009 Mbp (3.216 kbp) score=10
PGA1_c28700 LamB/YcsF family protein PGA1:3.009..3.009 Mbp (774 bp) score=10
PGA1_c28730 hypothetical protein PGA1:3.011..3.012 Mbp (780 bp) score=10
PGA1_c28740 aminotransferase class V, cysteine desulfurase-like protein PGA1:3.012..3.014 Mbp (1.47 kbp) score=10
PGA1_c28760 hypothetical protein PGA1:3.015..3.016 Mbp (804 bp) score=10
PGA1_c28780 acetyltransferase domain-containing protein PGA1:3.018..3.018 Mbp (582 bp) score=10
PGA1_c28790 hypothetical protein PGA1:3.018..3.02 Mbp (1.029 kbp) score=10
PGA1_c28800 HTH-type transcriptional regulator, ArsR family PGA1:3.02..3.02 Mbp (318 bp) score=10
PGA1_c28810 GntR family transcriptional regulator PGA1:3.02..3.022 Mbp (1.476 kbp) score=10
PGA1_c28830 sulfite exporter tauE/safE-like protein PGA1:3.024..3.024 Mbp (747 bp) score=10
PGA1_c28880 hypothetical protein PGA1:3.03..3.031 Mbp (582 bp) score=10
PGA1_c28890 polysulfide reductase chain B-like protein PGA1:3.031..3.032 Mbp (795 bp) score=10
PGA1_c28910 carboxymuconolactone decarboxylase-like protein PGA1:3.033..3.033 Mbp (471 bp) score=10
PGA1_c28950 hypothetical protein PGA1:3.037..3.038 Mbp (918 bp) score=10
PGA1_c29000 inner membrane lipoprotein PGA1:3.041..3.042 Mbp (660 bp) score=10
PGA1_c29010 helix-turn-helix protein PGA1:3.042..3.043 Mbp (708 bp) score=10
PGA1_c29020 hypothetical protein PGA1:3.043..3.043 Mbp (285 bp) score=10
pecS HTH-type transcriptional regulator PecS PGA1:3.046..3.047 Mbp (489 bp) score=10
pecM integral membrane protein PecM PGA1:3.047..3.048 Mbp (870 bp) score=10
PGA1_c29080 hypothetical protein PGA1:3.048..3.048 Mbp (504 bp) score=10
PGA1_c29120 hypothetical protein PGA1:3.052..3.052 Mbp (348 bp) score=10
PGA1_c29130 antibiotic biosynthesis monooxygenase-like protein PGA1:3.052..3.052 Mbp (357 bp) score=10
PGA1_c29140 hypothetical protein PGA1:3.052..3.053 Mbp (324 bp) score=10
PGA1_c29150 hypothetical protein PGA1:3.053..3.053 Mbp (456 bp) score=10
PGA1_c29160 LysR family transcriptional regulator PGA1:3.053..3.054 Mbp (906 bp) score=10
PGA1_c29180 peroxidase-like protein PGA1:3.055..3.056 Mbp (576 bp) score=10
PGA1_c29190 acetyltransferase (GNAT)-like protein PGA1:3.056..3.057 Mbp (744 bp) score=10
PGA1_c29200 molybdopterin-binding protein PGA1:3.057..3.057 Mbp (723 bp) score=10
sfsA sugar fermentation stimulation protein A PGA1:3.057..3.058 Mbp (699 bp) score=10
PGA1_c29240 hypothetical protein PGA1:3.06..3.06 Mbp (327 bp) score=10
PGA1_c29300 hypothetical protein PGA1:3.064..3.065 Mbp (1.188 kbp) score=10
PGA1_c29310 glycerophosphoryl diester phosphodiesterase-like protein PGA1:3.065..3.066 Mbp (774 bp) score=10
PGA1_c29340 HlyD family secretion protein PGA1:3.067..3.068 Mbp (1.317 kbp) score=10
aprD alkaline protease secretion ATP-binding protein AprD PGA1:3.068..3.07 Mbp (1.731 kbp) score=10
PGA1_c29360 VacJ-like lipoprotein PGA1:3.07..3.071 Mbp (780 bp) score=10
PGA1_c29370 toluene tolerance protein, Ttg2 family PGA1:3.071..3.071 Mbp (609 bp) score=10
PGA1_c29380 acetyltransferase (GNAT)-like protein PGA1:3.071..3.072 Mbp (486 bp) score=10
PGA1_c29390 penicillin-binding protein PGA1:3.072..3.074 Mbp (2.277 kbp) score=10
glnB2 nitrogen regulatory protein P-II PGA1:3.074..3.075 Mbp (339 bp) score=10
PGA1_c29440 hypothetical protein PGA1:3.078..3.079 Mbp (567 bp) score=10
smpB SsrA-binding protein SmpB PGA1:3.079..3.08 Mbp (477 bp) score=10
PGA1_c29460 hypothetical protein PGA1:3.08..3.081 Mbp (864 bp) score=10
PGA1_c29470 puttative helix-turn-helix protein PGA1:3.081..3.081 Mbp (555 bp) score=10
PGA1_c29480 inner membrane transport protein PGA1:3.081..3.083 Mbp (1.206 kbp) score=10
PGA1_c29500 NUDIX hydrolase-like protein PGA1:3.085..3.085 Mbp (468 bp) score=10
PGA1_c29510 hypothetical protein PGA1:3.085..3.086 Mbp (819 bp) score=10
PGA1_c29520 beta-1,6-N-acetylglucosaminyltransferase-like protein PGA1:3.086..3.088 Mbp (1.578 kbp) score=10
PGA1_c29530 hypothetical protein PGA1:3.088..3.089 Mbp (648 bp) score=10
PGA1_c29540 hypothetical protein PGA1:3.089..3.089 Mbp (267 bp) score=10
PGA1_c29550 hypothetical protein PGA1:3.089..3.09 Mbp (1.386 kbp) score=10
PGA1_c29560 hypothetical protein PGA1:3.091..3.091 Mbp (345 bp) score=10
PGA1_c29570 ATPase-like protein PGA1:3.091..3.093 Mbp (1.938 kbp) score=10
PGA1_c29580 hypothetical protein PGA1:3.093..3.094 Mbp (1.122 kbp) score=10
PGA1_c29590 hypothetical protein PGA1:3.095..3.095 Mbp (195 bp) score=10
PGA1_c29600 hypothetical protein PGA1:3.095..3.096 Mbp (1.116 kbp) score=10
PGA1_c29640 hypothetical protein PGA1:3.099..3.1 Mbp (786 bp) score=10
PGA1_c29660 hypothetical protein PGA1:3.102..3.104 Mbp (2.19 kbp) score=10
ibpA2 small heat shock protein IbpA PGA1:3.104..3.105 Mbp (459 bp) score=10
PGA1_c29680 serine protease-like protein PGA1:3.105..3.106 Mbp (816 bp) score=10
PGA1_c29690 serine protease-like protein PGA1:3.106..3.106 Mbp (855 bp) score=10
PGA1_c29730 hypothetical protein PGA1:3.111..3.111 Mbp (759 bp) score=10
PGA1_c29740 hypothetical protein PGA1:3.111..3.112 Mbp (369 bp) score=10
PGA1_c29760 hypothetical protein PGA1:3.112..3.113 Mbp (369 bp) score=10
PGA1_c29800 hypothetical protein PGA1:3.117..3.118 Mbp (990 bp) score=10
PGA1_c29810 hypothetical protein PGA1:3.118..3.119 Mbp (834 bp) score=10
PGA1_c29820 hypothetical protein PGA1:3.119..3.12 Mbp (1.065 kbp) score=10
PGA1_c29840 hypothetical protein PGA1:3.121..3.122 Mbp (957 bp) score=10
PGA1_c29860 hypothetical protein PGA1:3.123..3.123 Mbp (663 bp) score=10
PGA1_c29930 hypothetical protein PGA1:3.131..3.131 Mbp (168 bp) score=10
PGA1_c29960 glycosyl hydrolase-like protein PGA1:3.133..3.134 Mbp (840 bp) score=10
clpS ATP-dependent Clp protease adaptor protein ClpS PGA1:3.137..3.137 Mbp (342 bp) score=10
PGA1_c30010 haloacid dehalogenase-like protein PGA1:3.137..3.138 Mbp (714 bp) score=10
PGA1_c30020 hypothetical protein PGA1:3.138..3.138 Mbp (339 bp) score=10
ccoS cytochrome oxidase maturation protein CcoS PGA1:3.14..3.141 Mbp (159 bp) score=10
ccoH protein CcoH PGA1:3.143..3.143 Mbp (471 bp) score=10
ccoG cytochrome c accessory protein CcoG PGA1:3.143..3.145 Mbp (1.599 kbp) score=10
PGA1_c30080 hypothetical protein PGA1:3.145..3.146 Mbp (774 bp) score=10
PGA1_c30130 universal stress protein PGA1:3.15..3.151 Mbp (840 bp) score=10
PGA1_c30150 oligopeptide/dipeptide ABC transporter ATP-binding protein PGA1:3.152..3.153 Mbp (1.611 kbp) score=10
PGA1_c30180 ABC transporter extracellular solute-binding protein PGA1:3.156..3.158 Mbp (1.923 kbp) score=10
PGA1_c30210 hypothetical protein PGA1:3.159..3.16 Mbp (468 bp) score=10
PGA1_c30240 hypothetical protein PGA1:3.163..3.164 Mbp (699 bp) score=10
PGA1_c30250 phosphatase-like protein PGA1:3.164..3.165 Mbp (552 bp) score=10
PGA1_c30270 hypothetical protein PGA1:3.167..3.167 Mbp (375 bp) score=10
PGA1_c30280 hypothetical protein PGA1:3.167..3.168 Mbp (345 bp) score=10
recR recombination protein RecR PGA1:3.168..3.168 Mbp (600 bp) score=10
PGA1_c30310 hypothetical protein PGA1:3.169..3.17 Mbp (780 bp) score=10
PGA1_c30340 hypothetical protein PGA1:3.171..3.172 Mbp (858 bp) score=10
rpsU2 30S ribosomal protein S21 PGA1:3.174..3.174 Mbp (207 bp) score=10
PGA1_c30410 AsnC family transcriptional regulator PGA1:3.177..3.178 Mbp (459 bp) score=10
PGA1_c30430 TetR family transcriptional regulator PGA1:3.179..3.18 Mbp (600 bp) score=10
PGA1_c30450 DJ-1/PfpI family protein PGA1:3.181..3.181 Mbp (675 bp) score=10
PGA1_c30480 hypothetical protein PGA1:3.183..3.184 Mbp (1.002 kbp) score=10
PGA1_c30500 hypothetical protein PGA1:3.186..3.186 Mbp (606 bp) score=10
PGA1_c30510 leucine-responsive regulatory protein PGA1:3.186..3.187 Mbp (453 bp) score=10
PGA1_c30520 translocator protein, LysE family PGA1:3.187..3.188 Mbp (618 bp) score=10
PGA1_c30530 AraC family transcriptional regulator PGA1:3.188..3.188 Mbp (837 bp) score=10
PGA1_c30550 hypothetical protein PGA1:3.19..3.191 Mbp (903 bp) score=10
PGA1_c30560 GntR family HTH-type transcriptional regulator PGA1:3.191..3.191 Mbp (669 bp) score=10
PGA1_c30570 hypothetical protein PGA1:3.191..3.192 Mbp (693 bp) score=10
PGA1_c30580 hypothetical protein PGA1:3.192..3.192 Mbp (327 bp) score=10
PGA1_c30600 hypothetical protein PGA1:3.193..3.196 Mbp (2.88 kbp) score=10
PGA1_c30610 hypothetical protein PGA1:3.196..3.197 Mbp (213 bp) score=10
PGA1_c30640 hypothetical protein PGA1:3.199..3.2 Mbp (648 bp) score=10
PGA1_c30650 hypothetical protein PGA1:3.2..3.201 Mbp (1.332 kbp) score=10
PGA1_c30660 addiction module antidote protein, HigA family PGA1:3.201..3.202 Mbp (276 bp) score=10
PGA1_c30670 hypothetical protein PGA1:3.202..3.202 Mbp (588 bp) score=10
PGA1_c30680 hypothetical protein PGA1:3.203..3.203 Mbp (753 bp) score=10
PGA1_c30720 hypothetical protein PGA1:3.211..3.211 Mbp (297 bp) score=10
PGA1_c30730 helix-turn-helix protein PGA1:3.211..3.211 Mbp (423 bp) score=10
PGA1_c30740 hypothetical protein PGA1:3.211..3.212 Mbp (207 bp) score=10
PGA1_c30750 hypothetical protein PGA1:3.212..3.212 Mbp (237 bp) score=10
PGA1_c30780 hypothetical protein PGA1:3.215..3.215 Mbp (513 bp) score=10
PGA1_c30790 LysR family transcriptional regulator PGA1:3.216..3.217 Mbp (876 bp) score=10
PGA1_c30800 ABC transporter ATP-binding protein PGA1:3.217..3.218 Mbp (1.161 kbp) score=10
PGA1_c30830 ABC transporter extracellular solute-binding protein PGA1:3.22..3.221 Mbp (1.248 kbp) score=10
PGA1_c30840 phosphoesterase-like protein PGA1:3.221..3.222 Mbp (831 bp) score=10
PGA1_c30850 phosphoesterase-like protein PGA1:3.222..3.223 Mbp (855 bp) score=10
PGA1_c30860 hypothetical protein PGA1:3.223..3.224 Mbp (474 bp) score=10
PGA1_c30870 hypothetical protein PGA1:3.224..3.225 Mbp (360 bp) score=10
PGA1_c30880 hypothetical protein PGA1:3.225..3.225 Mbp (222 bp) score=10
PGA1_c30890 HipA-like protein PGA1:3.226..3.227 Mbp (1.227 kbp) score=10
PGA1_c30900 hypothetical protein PGA1:3.227..3.227 Mbp (312 bp) score=10
PGA1_c30930 hypothetical protein PGA1:3.229..3.23 Mbp (291 bp) score=10
PGA1_c30940 hypothetical protein PGA1:3.23..3.231 Mbp (603 bp) score=10
PGA1_c30950 hypothetical protein PGA1:3.231..3.232 Mbp (1.251 kbp) score=10
PGA1_c30970 hypothetical protein PGA1:3.232..3.234 Mbp (1.926 kbp) score=10
PGA1_c30980 hypothetical protein PGA1:3.234..3.235 Mbp (576 bp) score=10
PGA1_c30990 hypothetical protein PGA1:3.235..3.236 Mbp (387 bp) score=10
PGA1_c31000 hypothetical protein PGA1:3.236..3.237 Mbp (1.044 kbp) score=10
PGA1_c31010 dnaJ domain-containing protein PGA1:3.238..3.24 Mbp (2.139 kbp) score=10
PGA1_c31020 hypothetical protein PGA1:3.24..3.241 Mbp (1.038 kbp) score=10
PGA1_c31030 hypothetical protein PGA1:3.241..3.242 Mbp (804 bp) score=10
PGA1_c31040 hypothetical protein PGA1:3.242..3.242 Mbp (549 bp) score=10
PGA1_c31060 hypothetical protein PGA1:3.246..3.247 Mbp (855 bp) score=10
PGA1_c31070 hypothetical protein PGA1:3.247..3.248 Mbp (1.395 kbp) score=10
PGA1_c31075 hypothetical protein PGA1:3.248..3.248 Mbp (375 bp) score=10
PGA1_c31080 hypothetical protein PGA1:3.249..3.249 Mbp (684 bp) score=10
PGA1_c31100 hypothetical protein PGA1:3.25..3.25 Mbp (183 bp) score=10
PGA1_c31110 ribonuclease E/G family protein PGA1:3.25..3.251 Mbp (1.023 kbp) score=10
PGA1_c31120 hypothetical protein PGA1:3.251..3.252 Mbp (582 bp) score=10
PGA1_c31150 hypothetical protein PGA1:3.253..3.254 Mbp (591 bp) score=10
PGA1_c31160 hypothetical protein PGA1:3.254..3.254 Mbp (396 bp) score=10
PGA1_c31180 hypothetical protein PGA1:3.255..3.255 Mbp (480 bp) score=10
PGA1_c31210 hypothetical protein PGA1:3.257..3.258 Mbp (477 bp) score=10
PGA1_c31230 hypothetical protein PGA1:3.259..3.259 Mbp (180 bp) score=10
PGA1_c31250 hypothetical protein PGA1:3.261..3.261 Mbp (621 bp) score=10
PGA1_c31260 hypothetical protein PGA1:3.261..3.264 Mbp (2.433 kbp) score=10
PGA1_c31290 ABC transporter ATP-binding protein PGA1:3.269..3.27 Mbp (921 bp) score=10
PGA1_c31300 ABC transporter ATP-binding protein PGA1:3.27..3.271 Mbp (1.113 kbp) score=10
PGA1_c31310 hypothetical protein PGA1:3.271..3.272 Mbp (1.125 kbp) score=10
PGA1_c31340 DeoR family HTH-type transcriptional regulator PGA1:3.275..3.276 Mbp (837 bp) score=10
PGA1_c31380 hypothetical protein PGA1:3.279..3.28 Mbp (168 bp) score=10
PGA1_c31410 receptor family ligand-binding protein PGA1:3.282..3.283 Mbp (1.185 kbp) score=10
PGA1_c31420 branched-chain amino acid transport system ATP-binding protein PGA1:3.283..3.284 Mbp (777 bp) score=10
PGA1_c31430 branched-chain amino acid transport system ATP-binding protein PGA1:3.284..3.285 Mbp (750 bp) score=10
PGA1_c31460 hypothetical protein PGA1:3.287..3.289 Mbp (1.707 kbp) score=10
PGA1_c31470 hypothetical protein PGA1:3.289..3.289 Mbp (336 bp) score=10
PGA1_c31500 hypothetical protein PGA1:3.292..3.293 Mbp (1.155 kbp) score=10
PGA1_c31520 hypothetical protein PGA1:3.294..3.294 Mbp (324 bp) score=10
PGA1_c31540 hypothetical protein PGA1:3.296..3.297 Mbp (849 bp) score=10
PGA1_c31550 hypothetical protein PGA1:3.297..3.297 Mbp (384 bp) score=10
PGA1_c31560 HTH-type transcriptional regulator, ArsR family PGA1:3.297..3.298 Mbp (708 bp) score=10
PGA1_c31570 cytochrome c-like protein PGA1:3.298..3.299 Mbp (549 bp) score=10
PGA1_c31580 HTH-type transcriptional regulator, TetR family PGA1:3.299..3.299 Mbp (645 bp) score=10
PGA1_c31590 membrane transport protein PGA1:3.3..3.301 Mbp (939 bp) score=10
PGA1_c31620 hypothetical protein PGA1:3.303..3.304 Mbp (453 bp) score=10
PGA1_c31630 hypothetical protein PGA1:3.304..3.305 Mbp (966 bp) score=10
PGA1_c31640 haloacid dehalogenase-like protein PGA1:3.305..3.305 Mbp (621 bp) score=10
PGA1_c31650 ornithine cyclodeaminase/mu-crystallin family protein PGA1:3.305..3.306 Mbp (921 bp) score=10
PGA1_c31700 protease-like protein PGA1:3.311..3.312 Mbp (921 bp) score=10
PGA1_c31710 cyclic nucleotide-binding ABC transporter transmembrane protein PGA1:3.312..3.315 Mbp (3.219 kbp) score=10
PGA1_c31720 hypothetical protein PGA1:3.316..3.316 Mbp (600 bp) score=10
PGA1_c31730 hypothetical protein PGA1:3.316..3.317 Mbp (762 bp) score=10
PGA1_c31740 hypothetical protein PGA1:3.317..3.318 Mbp (378 bp) score=10
PGA1_c31750 ABC transporter ATP-binding protein PGA1:3.318..3.319 Mbp (933 bp) score=10
PGA1_c31760 hypothetical protein PGA1:3.319..3.319 Mbp (183 bp) score=10
PGA1_c31770 signaling protein with diguanylate cyclase/phosphodiesterase activity PGA1:3.319..3.321 Mbp (2.055 kbp) score=10
PGA1_c31790 hypothetical protein PGA1:3.324..3.325 Mbp (258 bp) score=10
ygbM protein YgbM PGA1:3.325..3.325 Mbp (753 bp) score=10
PGA1_c31810 hypothetical protein PGA1:3.326..3.326 Mbp (498 bp) score=10
PGA1_c31830 hypothetical protein PGA1:3.327..3.328 Mbp (924 bp) score=10
PGA1_c31840 hypothetical protein PGA1:3.328..3.331 Mbp (2.919 kbp) score=10
PGA1_c31850 hypothetical protein PGA1:3.331..3.333 Mbp (2.061 kbp) score=10
pbpC penicillin-binding protein PbpC PGA1:3.333..3.335 Mbp (2.028 kbp) score=10
PGA1_c31870 alpha-2-macroglobulin family protein PGA1:3.335..3.341 Mbp (5.31 kbp) score=10
PGA1_c31890 hypothetical protein PGA1:3.343..3.344 Mbp (765 bp) score=10
PGA1_c31910 hypothetical protein PGA1:3.346..3.347 Mbp (288 bp) score=10
PGA1_c31920 thioeseterase-like protein PGA1:3.347..3.347 Mbp (588 bp) score=10
PGA1_c31950 hypothetical protein PGA1:3.35..3.351 Mbp (930 bp) score=10
PGA1_c31960 hypothetical protein PGA1:3.351..3.352 Mbp (633 bp) score=10
PGA1_c31970 peptidyl-tRNA hydrolase-like protein PGA1:3.352..3.352 Mbp (420 bp) score=10
PGA1_c32020 hypothetical protein PGA1:3.356..3.357 Mbp (1.257 kbp) score=10
gsiB3 glutathione-binding protein GsiB PGA1:3.361..3.362 Mbp (1.479 kbp) score=10
PGA1_c32070 hypothetical protein PGA1:3.362..3.363 Mbp (1.185 kbp) score=10
gsiA5 glutathione import ATP-binding protein GsiA PGA1:3.365..3.367 Mbp (1.608 kbp) score=10
PGA1_c32110 hypothetical protein PGA1:3.367..3.367 Mbp (474 bp) score=10
PGA1_c32160 hypothetical protein PGA1:3.373..3.374 Mbp (915 bp) score=10
PGA1_c32170 hypothetical protein PGA1:3.375..3.375 Mbp (210 bp) score=10
PGA1_c32180 hypothetical protein PGA1:3.375..3.376 Mbp (990 bp) score=10
PGA1_c32200 fumarylacetoacetate hydrolase family protein PGA1:3.377..3.378 Mbp (855 bp) score=10
PGA1_c32240 hypothetical protein PGA1:3.38..3.382 Mbp (1.26 kbp) score=10
PGA1_c32260 hypothetical protein PGA1:3.383..3.385 Mbp (1.518 kbp) score=10
PGA1_c32270 hypothetical protein PGA1:3.385..3.385 Mbp (540 bp) score=10
PGA1_c32280 hypothetical protein PGA1:3.385..3.386 Mbp (945 bp) score=10
PGA1_c32290 IclR family HTH-type transcriptional regulator PGA1:3.386..3.387 Mbp (810 bp) score=10
PGA1_c32390 hypothetical protein PGA1:3.396..3.396 Mbp (597 bp) score=10
PGA1_c32410 glutamate synthase-like protein PGA1:3.397..3.399 Mbp (1.494 kbp) score=10
PGA1_c32420 hypothetical protein PGA1:3.399..3.399 Mbp (507 bp) score=10
PGA1_c32430 hypothetical protein PGA1:3.399..3.4 Mbp (558 bp) score=10
clpB chaperone protein ClpB PGA1:3.4..3.403 Mbp (2.7 kbp) score=10
rpmJ 50S ribosomal protein L36 PGA1:3.407..3.407 Mbp (126 bp) score=10
futA iron uptake protein FutA PGA1:3.408..3.409 Mbp (1.017 kbp) score=10
PGA1_c32520 hypothetical protein PGA1:3.409..3.409 Mbp (543 bp) score=10
PGA1_c32530 CobW-like nucleotide-binding protein PGA1:3.41..3.41 Mbp (867 bp) score=10
sfuB Fe(3+)-transport system protein SfuB PGA1:3.41..3.412 Mbp (1.761 kbp) score=10
PGA1_c32560 high-affinity branched-chain amino acid transport ATP-binding protein PGA1:3.414..3.414 Mbp (837 bp) score=10
PGA1_c32590 hypothetical protein PGA1:3.417..3.417 Mbp (258 bp) score=10
PGA1_c32600 hypothetical protein PGA1:3.417..3.418 Mbp (345 bp) score=10
PGA1_c32620 high-affinity branched-chain amino acid transport ATP-binding protein PGA1:3.419..3.42 Mbp (810 bp) score=10
PGA1_c32640 response regulator receiver protein PGA1:3.422..3.424 Mbp (1.902 kbp) score=10
PGA1_c32660 hypothetical protein PGA1:3.425..3.425 Mbp (228 bp) score=10
PGA1_c32670 phosphoglycerate mutase family protein PGA1:3.425..3.426 Mbp (651 bp) score=10
PGA1_c32710 hypothetical protein PGA1:3.429..3.429 Mbp (324 bp) score=10
PGA1_c32730 RmuC DNA recombination family protein PGA1:3.431..3.432 Mbp (1.23 kbp) score=10
mutL DNA mismatch repair protein MutL PGA1:3.432..3.434 Mbp (1.953 kbp) score=10
mntD manganese transport system membrane protein MntD PGA1:3.434..3.435 Mbp (930 bp) score=10
mntC manganese transport system membrane protein MntC PGA1:3.435..3.436 Mbp (1.206 kbp) score=10
mntB manganese transport system ATP-binding protein MntB PGA1:3.436..3.437 Mbp (849 bp) score=10
mntA manganese-binding lipoprotein MntA PGA1:3.437..3.438 Mbp (1.011 kbp) score=10
PGA1_c32830 hypothetical protein PGA1:3.444..3.445 Mbp (198 bp) score=10
PGA1_c32840 hypothetical protein PGA1:3.445..3.445 Mbp (516 bp) score=10
PGA1_c32850 lipoprotein signal peptidase PGA1:3.445..3.446 Mbp (483 bp) score=10
purH bifunctional purine biosynthesis protein PurH PGA1:3.446..3.447 Mbp (1.59 kbp) score=10
PGA1_c32870 heparinase II/III-like protein PGA1:3.447..3.449 Mbp (1.743 kbp) score=10
PGA1_c32890 hypothetical protein PGA1:3.451..3.451 Mbp (195 bp) score=10
PGA1_c32900 hypothetical protein PGA1:3.451..3.451 Mbp (156 bp) score=10
PGA1_c32910 hypothetical protein PGA1:3.451..3.451 Mbp (180 bp) score=10
PGA1_c32940 hypothetical protein PGA1:3.453..3.453 Mbp (738 bp) score=10
PGA1_c32960 hypothetical protein PGA1:3.454..3.455 Mbp (519 bp) score=10
PGA1_c32970 hypothetical protein PGA1:3.455..3.456 Mbp (1.047 kbp) score=10
rpsO 30S ribosomal protein S15 PGA1:3.456..3.456 Mbp (270 bp) score=10
PGA1_c33010 glycosyltransferase-like protein PGA1:3.461..3.462 Mbp (714 bp) score=10
PGA1_c33030 hypothetical protein PGA1:3.462..3.462 Mbp (165 bp) score=10
PGA1_c33050 hypothetical protein PGA1:3.464..3.465 Mbp (474 bp) score=10
PGA1_c33055 hypothetical protein PGA1:3.465..3.465 Mbp (252 bp) score=10
PGA1_c33060 glyoxalase-like protein PGA1:3.465..3.465 Mbp (504 bp) score=10
PGA1_c33070 hypothetical protein PGA1:3.465..3.466 Mbp (858 bp) score=10
PGA1_c33090 hypothetical protein PGA1:3.467..3.468 Mbp (414 bp) score=10
PGA1_c33095 hypothetical protein PGA1:3.468..3.468 Mbp (828 bp) score=10
rarD protein RarD PGA1:3.468..3.469 Mbp (894 bp) score=10
PGA1_c33120 HTH-type transcriptional regulator, AraC family PGA1:3.472..3.473 Mbp (1.029 kbp) score=10
PGA1_c33160 helix-turn-helix protein PGA1:3.476..3.477 Mbp (570 bp) score=10
PGA1_c33170 sensor protein PGA1:3.477..3.478 Mbp (456 bp) score=10
PGA1_c33200 serine-protein kinase (anti-sigma-B factor) PGA1:3.479..3.48 Mbp (447 bp) score=10
PGA1_c33230 thioredoxin-like protein PGA1:3.482..3.483 Mbp (936 bp) score=10
PGA1_c33250 hypothetical protein PGA1:3.484..3.484 Mbp (207 bp) score=10
lolA outer membrane lipoprotein LolA PGA1:3.491..3.492 Mbp (588 bp) score=10
PGA1_c33310 hypothetical protein PGA1:3.492..3.493 Mbp (588 bp) score=10
PGA1_c33330 transcriptional regulator PGA1:3.494..3.495 Mbp (687 bp) score=10
PGA1_c33350 hypothetical protein PGA1:3.496..3.496 Mbp (492 bp) score=10
PGA1_c33390 hypothetical protein PGA1:3.498..3.499 Mbp (489 bp) score=10
PGA1_c33410 hypothetical protein PGA1:3.502..3.502 Mbp (543 bp) score=10
PGA1_c33420 DNA polymerase 3-like protein PGA1:3.502..3.503 Mbp (1.029 kbp) score=10
PGA1_c33430 glutathione S-transferase-like protein PGA1:3.503..3.504 Mbp (591 bp) score=10
PGA1_c33440 hypothetical protein PGA1:3.504..3.505 Mbp (1.224 kbp) score=10
PGA1_c33470 hypothetical protein PGA1:3.507..3.508 Mbp (1.524 kbp) score=10
pmbA protein PmbA PGA1:3.509..3.51 Mbp (1.347 kbp) score=10
PGA1_c33520 hypothetical protein PGA1:3.513..3.514 Mbp (672 bp) score=10
PGA1_c33530 hypothetical protein PGA1:3.514..3.514 Mbp (528 bp) score=10
PGA1_c33590 hypothetical protein PGA1:3.52..3.521 Mbp (498 bp) score=10
PGA1_c33600 hypothetical protein PGA1:3.521..3.521 Mbp (306 bp) score=10
PGA1_c33610 hypothetical protein PGA1:3.521..3.522 Mbp (702 bp) score=10
PGA1_c33620 hypothetical protein PGA1:3.522..3.524 Mbp (1.617 kbp) score=10
PGA1_c33660 hypothetical protein PGA1:3.529..3.529 Mbp (219 bp) score=10
PGA1_c33700 hypothetical protein PGA1:3.532..3.534 Mbp (1.593 kbp) score=10
PGA1_c33710 LysR family transcriptional regulator PGA1:3.534..3.535 Mbp (996 bp) score=10
PGA1_c33740 LysR family transcriptional regulator PGA1:3.537..3.538 Mbp (885 bp) score=10
PGA1_c33750 glycine betaine transport system substrate binding protein PGA1:3.538..3.539 Mbp (966 bp) score=10
PGA1_c33760 glycine betaine transport ATP-binding protein PGA1:3.539..3.54 Mbp (1.056 kbp) score=10
PGA1_c33790 LysR family HTH-type transcriptional regulator PGA1:3.543..3.544 Mbp (822 bp) score=10
PGA1_c33800 class 2 aldolase,like protein PGA1:3.544..3.545 Mbp (723 bp) score=10
PGA1_c33820 ABC transporter extracellular solute-binding protein PGA1:3.546..3.548 Mbp (1.641 kbp) score=10
PGA1_c33830 hypothetical protein PGA1:3.548..3.549 Mbp (912 bp) score=10
PGA1_c33840 phosphoesterase-like protein PGA1:3.549..3.55 Mbp (906 bp) score=10
PGA1_c33850 hypothetical protein PGA1:3.55..3.551 Mbp (1.101 kbp) score=10
PGA1_c33870 HTH-type transcriptional regulator GntR PGA1:3.552..3.553 Mbp (1.026 kbp) score=10
PGA1_c33880 hypothetical protein PGA1:3.553..3.554 Mbp (1.227 kbp) score=10
PGA1_c33890 thioesterase-like protein PGA1:3.554..3.554 Mbp (441 bp) score=10
PGA1_c33930 fumarylacetoacetate hydrolase family protein PGA1:3.558..3.559 Mbp (690 bp) score=10
PGA1_c33970 chloramphenicol phosphotransferase-like protein PGA1:3.561..3.562 Mbp (522 bp) score=10
PGA1_c34010 glutathione S-transferase-like protein PGA1:3.565..3.566 Mbp (603 bp) score=10
thiQ thiamine import ATP-binding protein ThiQ PGA1:3.566..3.567 Mbp (693 bp) score=10
thiB thiamine-binding periplasmic protein ThiB PGA1:3.569..3.57 Mbp (978 bp) score=10
ohrR organic hydroperoxide resistance transcriptional regulator PGA1:3.574..3.574 Mbp (447 bp) score=10
ohr organic hydroperoxide resistance protein Ohr PGA1:3.574..3.575 Mbp (429 bp) score=10
petP HTH-type transcriptional regulator PetP PGA1:3.576..3.576 Mbp (513 bp) score=10
petR protein PetR PGA1:3.576..3.577 Mbp (702 bp) score=10
PGA1_c34180 NAD dependent epimerase / dehydratase-like protein PGA1:3.581..3.582 Mbp (888 bp) score=10
PGA1_c34190 methyltransferase-like protein PGA1:3.582..3.583 Mbp (636 bp) score=10
PGA1_c34210 hypothetical protein PGA1:3.584..3.586 Mbp (2.067 kbp) score=10
PGA1_c34230 HTH-type transcriptional regulator, AraC family PGA1:3.587..3.588 Mbp (945 bp) score=10
hupB DNA-binding protein HU-beta PGA1:3.592..3.592 Mbp (288 bp) score=10
PGA1_c34270 hypothetical protein PGA1:3.592..3.593 Mbp (885 bp) score=10
PGA1_c34300 hydantoinase / oxoprolinase family protein PGA1:3.594..3.596 Mbp (2.007 kbp) score=10
PGA1_c34310 hypothetical protein PGA1:3.596..3.597 Mbp (1.053 kbp) score=10
PGA1_c34340 HTH-type transcriptional regulator PGA1:3.6..3.601 Mbp (567 bp) score=10
potC spermidine/putrescine transport system permease protein PotC PGA1:3.602..3.603 Mbp (1.176 kbp) score=10
PGA1_c34380 spermidine/putrescine transport system extracellular solute-binding protein PGA1:3.604..3.606 Mbp (1.107 kbp) score=10
potA spermidine/putrescine import ATP-binding protein PotA PGA1:3.606..3.607 Mbp (1.101 kbp) score=10
PGA1_c34410 GntR family HTH-type transcriptional regulator PGA1:3.609..3.609 Mbp (723 bp) score=10
potF putrescine-binding periplasmic protein PotF PGA1:3.609..3.61 Mbp (1.086 kbp) score=10
potG putrescine transport ATP-binding protein PotG PGA1:3.611..3.612 Mbp (1.128 kbp) score=10
PGA1_c34460 hypothetical protein PGA1:3.613..3.614 Mbp (1.068 kbp) score=10
PGA1_c34510 hypothetical protein PGA1:3.618..3.619 Mbp (822 bp) score=10
dnaK chaperone protein DnaK PGA1:3.62..3.622 Mbp (1.92 kbp) score=10
dnaJ chaperone protein DnaJ PGA1:3.622..3.623 Mbp (1.164 kbp) score=10
radC DNA repair protein RadC PGA1:3.623..3.624 Mbp (765 bp) score=10
PGA1_c34560 hypothetical protein PGA1:3.624..3.626 Mbp (1.557 kbp) score=10
PGA1_c34570 hypothetical protein PGA1:3.626..3.627 Mbp (924 bp) score=10
secA protein translocase subunit SecA PGA1:3.627..3.629 Mbp (2.7 kbp) score=10
argJ arginine biosynthesis bifunctional protein ArgJ PGA1:3.63..3.632 Mbp (1.23 kbp) score=10
PGA1_c34610 mutator MutT protein PGA1:3.632..3.632 Mbp (399 bp) score=10
PGA1_c34630 hypothetical protein PGA1:3.635..3.636 Mbp (621 bp) score=10
nusA transcription elongation protein NusA PGA1:3.636..3.637 Mbp (1.626 kbp) score=10
yhbC hypothetical protein PGA1:3.637..3.638 Mbp (591 bp) score=10
PGA1_c34660 extracellular solute-binding protein PGA1:3.638..3.639 Mbp (846 bp) score=10
PGA1_c34690 HTH-type transcriptional regulator, MarR family PGA1:3.641..3.641 Mbp (441 bp) score=10
PGA1_c34720 phosphoribosyl transferase-like protein PGA1:3.643..3.643 Mbp (729 bp) score=10
PGA1_c34730 hypothetical protein PGA1:3.643..3.644 Mbp (831 bp) score=10
PGA1_c34760 hypothetical protein PGA1:3.649..3.649 Mbp (183 bp) score=10
PGA1_c34770 hypothetical protein PGA1:3.649..3.65 Mbp (642 bp) score=10
PGA1_c34780 hypothetical protein PGA1:3.65..3.65 Mbp (492 bp) score=10
PGA1_c34790 hypothetical protein PGA1:3.65..3.651 Mbp (519 bp) score=10
PGA1_c34800 ion transport protein PGA1:3.651..3.652 Mbp (810 bp) score=10
PGA1_c34820 ABC transporter ATP-binding protein PGA1:3.653..3.655 Mbp (1.872 kbp) score=10
PGA1_c34830 ABC transporter ATP-binding protein PGA1:3.655..3.657 Mbp (1.839 kbp) score=10
hslO 33 kDa chaperonin (heat shock protein 33) PGA1:3.659..3.66 Mbp (1.002 kbp) score=10
PGA1_c34890 histidine-containing phosphotransfer protein PGA1:3.662..3.662 Mbp (324 bp) score=10
PGA1_c34910 hypothetical protein PGA1:3.663..3.664 Mbp (750 bp) score=10
PGA1_c34930 hypothetical protein PGA1:3.665..3.666 Mbp (459 bp) score=10
PGA1_c34940 hypothetical protein PGA1:3.666..3.666 Mbp (285 bp) score=10
mutS DNA mismatch repair protein MutS PGA1:3.672..3.675 Mbp (2.634 kbp) score=10
grpE protein GrpE PGA1:3.675..3.676 Mbp (564 bp) score=10
PGA1_c35060 inner membrane protein PGA1:3.679..3.68 Mbp (354 bp) score=10
parB chromosome-partitioning protein ParB PGA1:3.68..3.68 Mbp (894 bp) score=10
parA chromosome partitioning protein ParA PGA1:3.68..3.681 Mbp (801 bp) score=10
PGA1_c35130 hypothetical protein PGA1:3.687..3.687 Mbp (456 bp) score=10
PGA1_c35140 Maf-like protein PGA1:3.687..3.688 Mbp (600 bp) score=10
fxsA protein FxsA PGA1:3.691..3.691 Mbp (507 bp) score=10
PGA1_c35200 transporter protein PGA1:3.691..3.692 Mbp (657 bp) score=10
PGA1_c35220 hypothetical protein PGA1:3.693..3.694 Mbp (603 bp) score=10
PGA1_c35230 hypothetical protein PGA1:3.694..3.695 Mbp (1.146 kbp) score=10
PGA1_c35250 hypothetical protein PGA1:3.696..3.697 Mbp (1.071 kbp) score=10
PGA1_c35270 hypothetical protein PGA1:3.698..3.698 Mbp (195 bp) score=10
PGA1_c35280 hypothetical protein PGA1:3.699..3.699 Mbp (366 bp) score=10
PGA1_c35290 hypothetical protein PGA1:3.699..3.699 Mbp (348 bp) score=10
addB double strand break repair protein AddB PGA1:3.703..3.706 Mbp (2.934 kbp) score=10
PGA1_c35330 nucleotidyl transferase-like protein PGA1:3.706..3.707 Mbp (675 bp) score=10
PGA1_c35350 hypothetical protein PGA1:3.708..3.708 Mbp (480 bp) score=10
PGA1_c35360 PAS domain-containing protein PGA1:3.708..3.71 Mbp (1.551 kbp) score=10
senC regulatory protein SenC PGA1:3.712..3.712 Mbp (621 bp) score=10
regA photosynthetic apparatus regulatory protein RegA PGA1:3.712..3.713 Mbp (555 bp) score=10
PGA1_c35400 metal-dependent phosphohydrolase-like protein PGA1:3.713..3.714 Mbp (597 bp) score=10
PGA1_c35410 hypothetical protein PGA1:3.714..3.714 Mbp (315 bp) score=10
PGA1_c35430 PRC-barrel domain-containing protein PGA1:3.716..3.717 Mbp (660 bp) score=10
PGA1_c35440 hypothetical protein PGA1:3.717..3.717 Mbp (342 bp) score=10
PGA1_c35450 hypothetical protein PGA1:3.718..3.718 Mbp (396 bp) score=10
PGA1_c35460 hypothetical protein PGA1:3.718..3.718 Mbp (423 bp) score=10
yciI protein YciI PGA1:3.718..3.719 Mbp (273 bp) score=10
PGA1_c35490 O-sialoglycoprotein endopeptidase PGA1:3.72..3.721 Mbp (1.098 kbp) score=10
PGA1_c35500 uoporphyrinogen-III synthase HemD-like protein PGA1:3.721..3.722 Mbp (768 bp) score=10
PGA1_c35510 hypothetical protein PGA1:3.722..3.723 Mbp (1.383 kbp) score=10
PGA1_c35520 HemY-like protein PGA1:3.723..3.725 Mbp (1.524 kbp) score=10
flgE flagellar hook protein FlgE PGA1:3.729..3.731 Mbp (1.323 kbp) score=10
flgK flagellar hook-associated protein FlgK PGA1:3.731..3.732 Mbp (1.449 kbp) score=10
PGA1_c35590 hypothetical protein PGA1:3.732..3.733 Mbp (1.008 kbp) score=10
flgI flagellar P-ring protein FlgI PGA1:3.733..3.734 Mbp (1.104 kbp) score=10
fliP flagellar biosynthetic protein FliP PGA1:3.735..3.735 Mbp (744 bp) score=10
fliN flagellar motor switch protein FliN PGA1:3.735..3.736 Mbp (297 bp) score=10
PGA1_c35630 flagellar biosynthesis protein PGA1:3.736..3.736 Mbp (597 bp) score=10
fliF flagellar M-ring protein FliF PGA1:3.736..3.738 Mbp (1.686 kbp) score=10
fliL1 flagellar basal body-associated protein FliL PGA1:3.738..3.739 Mbp (525 bp) score=10
PGA1_c35660 hypothetical protein PGA1:3.739..3.739 Mbp (465 bp) score=10
PGA1_c35670 hypothetical protein PGA1:3.739..3.74 Mbp (648 bp) score=10
motA chemotaxis protein MotA PGA1:3.74..3.741 Mbp (870 bp) score=10
PGA1_c35690 hypothetical protein PGA1:3.741..3.743 Mbp (2.457 kbp) score=10
flhA flagellar biosynthetic protein FlhA PGA1:3.744..3.746 Mbp (2.094 kbp) score=10
fliR flagellar biosynthetic protein FliR PGA1:3.746..3.747 Mbp (780 bp) score=10
flhB flagellar biosynthetic protein FlhB PGA1:3.747..3.748 Mbp (1.08 kbp) score=10
PGA1_c35740 hypothetical protein PGA1:3.748..3.748 Mbp (402 bp) score=10
fliL2 flagellar basal body-associated protein FliL PGA1:3.748..3.749 Mbp (483 bp) score=10
flgH flagellar L-ring protein FlgH PGA1:3.749..3.75 Mbp (741 bp) score=10
flgA flagella basal body P-ring formation protein FlgA PGA1:3.75..3.75 Mbp (417 bp) score=10
flgG flagellar basal-body rod protein FlgG PGA1:3.75..3.751 Mbp (786 bp) score=10
flgF flagellar basal-body rod protein FlgF PGA1:3.751..3.752 Mbp (717 bp) score=10
fliQ flagellar biosynthetic protein FliQ PGA1:3.752..3.752 Mbp (273 bp) score=10
fliE flagellar hook-basal body complex protein FliE PGA1:3.752..3.752 Mbp (297 bp) score=10
flgC flagellar basal-body rod protein FlgC PGA1:3.752..3.753 Mbp (393 bp) score=10
flgB flagellar basal-body rod protein FlgB PGA1:3.753..3.753 Mbp (390 bp) score=10
flaF flagellar protein FlaF PGA1:3.756..3.756 Mbp (372 bp) score=10
PGA1_c35880 FlgN-like protein PGA1:3.757..3.757 Mbp (360 bp) score=10
PGA1_c35890 rod-binding protein PGA1:3.757..3.758 Mbp (291 bp) score=10
PGA1_c35900 flagellar hook-length control protein PGA1:3.758..3.76 Mbp (1.704 kbp) score=10
PGA1_c35910 flagellar hook capping protein PGA1:3.76..3.76 Mbp (693 bp) score=10
PGA1_c35920 thiamine kinase ThiK-like protein PGA1:3.76..3.761 Mbp (888 bp) score=10
PGA1_c35930 hypothetical protein PGA1:3.761..3.762 Mbp (987 bp) score=10
PGA1_c35940 hypothetical protein PGA1:3.762..3.764 Mbp (1.701 kbp) score=10
PGA1_c35950 hypothetical protein PGA1:3.764..3.766 Mbp (1.431 kbp) score=10
ptsN nitrogen regulatory protein PtsN PGA1:3.766..3.766 Mbp (465 bp) score=10
PGA1_c35970 sigma(54) modulation protein PGA1:3.766..3.767 Mbp (564 bp) score=10
lptB lipopolysaccharide export system ATP-binding protein LptB PGA1:3.767..3.768 Mbp (759 bp) score=10
PGA1_c36000 hypothetical protein PGA1:3.768..3.769 Mbp (600 bp) score=10
PGA1_c36170 hypothetical protein PGA1:3.787..3.788 Mbp (759 bp) score=10
PGA1_c36180 HTH-type transcriptional regulator, ArsR family PGA1:3.788..3.788 Mbp (321 bp) score=10
PGA1_c36200 hypothetical protein PGA1:3.789..3.789 Mbp (315 bp) score=10
PGA1_c36220 hypothetical protein PGA1:3.79..3.791 Mbp (579 bp) score=10
PGA1_c36230 hypothetical protein PGA1:3.791..3.791 Mbp (162 bp) score=10
PGA1_c36270 hypothetical protein PGA1:3.794..3.794 Mbp (132 bp) score=10
PGA1_c36280 hypothetical protein PGA1:3.794..3.795 Mbp (849 bp) score=10
PGA1_c36300 GntR family HTH-type transcriptional regulator PGA1:3.796..3.797 Mbp (606 bp) score=10
PGA1_c36370 GntR family HTH-type transcriptional regulator PGA1:3.805..3.806 Mbp (741 bp) score=10
PGA1_c36380 hypothetical protein PGA1:3.806..3.806 Mbp (348 bp) score=10
PGA1_c36390 ABC transporter extracellular solute-binding protein PGA1:3.806..3.807 Mbp (1.056 kbp) score=10
PGA1_c36400 hypothetical protein PGA1:3.807..3.808 Mbp (1.128 kbp) score=10
PGA1_c36410 hypothetical protein PGA1:3.808..3.81 Mbp (1.578 kbp) score=10
PGA1_c36440 hypothetical protein PGA1:3.814..3.814 Mbp (447 bp) score=10
PGA1_c36450 DNA-binding protein PGA1:3.814..3.815 Mbp (735 bp) score=10
ubiB ubiquinone biosynthesis protein UbiB PGA1:3.817..3.818 Mbp (1.536 kbp) score=10
rpsT 30S ribosomal protein S20 PGA1:3.821..3.821 Mbp (264 bp) score=10
PGA1_65p00010 replication initiation protein PGA1:3.822..3.823 Mbp (1.026 kbp) score=10
PGA1_65p00020 type I secretion membrane fusion protein PGA1:3.823..3.825 Mbp (1.404 kbp) score=10
PGA1_65p00040 hypothetical protein PGA1:3.827..3.829 Mbp (2.514 kbp) score=10
PGA1_65p00050 hypothetical protein PGA1:3.829..3.83 Mbp (843 bp) score=10
PGA1_65p00060 regulatory protein, LuxR family PGA1:3.83..3.831 Mbp (1.2 kbp) score=10
PGA1_65p00070 regulatory protein, LuxR family PGA1:3.832..3.833 Mbp (801 bp) score=10
PGA1_65p00090 hypothetical protein PGA1:3.835..3.837 Mbp (2.01 kbp) score=10
PGA1_65p00100 hypothetical protein PGA1:3.837..3.838 Mbp (552 bp) score=10
PGA1_65p00110 amino-acid ABC transporter, periplasmic solute-binding protein PGA1:3.838..3.839 Mbp (777 bp) score=10
PGA1_65p00120 amino-acid ABC transporter, permease protein PGA1:3.839..3.84 Mbp (675 bp) score=10
PGA1_65p00130 amino-acid ABC transporter, ATP-binding protein PGA1:3.84..3.84 Mbp (756 bp) score=10
PGA1_65p00140 hypothetical protein PGA1:3.841..3.841 Mbp (207 bp) score=10
PGA1_65p00150 hypothetical protein PGA1:3.841..3.842 Mbp (726 bp) score=10
PGA1_65p00160 hypothetical protein PGA1:3.842..3.844 Mbp (2.133 kbp) score=10
PGA1_65p00170 capsular polysaccharide biosynthesis protein PGA1:3.844..3.846 Mbp (1.848 kbp) score=10
PGA1_65p00200 polysaccharide biosynthesis/export protein PGA1:3.848..3.849 Mbp (1.14 kbp) score=10
PGA1_65p00210 hypothetical protein PGA1:3.85..3.85 Mbp (855 bp) score=10
PGA1_65p00270 hypothetical protein PGA1:3.856..3.858 Mbp (2.22 kbp) score=10
PGA1_65p00280 hypothetical protein PGA1:3.858..3.86 Mbp (1.257 kbp) score=10
PGA1_65p00290 algA: alginate biosynthesis protein PGA1:3.86..3.861 Mbp (1.422 kbp) score=10
PGA1_65p00320 type I secretion membrane fusion protein PGA1:3.864..3.865 Mbp (1.308 kbp) score=10
PGA1_65p00340 hypothetical protein PGA1:3.867..3.868 Mbp (1.221 kbp) score=10
PGA1_65p00350 hemolysin-like protein PGA1:3.869..3.87 Mbp (1.602 kbp) score=10
PGA1_65p00360 glycosyl transferase domain-containing protein PGA1:3.871..3.873 Mbp (2.718 kbp) score=10
PGA1_65p00380 hypothetical protein PGA1:3.874..3.876 Mbp (1.32 kbp) score=10
PGA1_65p00400 ABC transporter ATP-binding protein PGA1:3.877..3.878 Mbp (657 bp) score=10
PGA1_65p00410 olysaccharide export protein PGA1:3.878..3.879 Mbp (1.431 kbp) score=10
PGA1_65p00460 plasmid partition protein B PGA1:3.884..3.885 Mbp (1.128 kbp) score=10
PGA1_65p00470 plasmid partition protein A PGA1:3.885..3.887 Mbp (1.416 kbp) score=10
repB replication initiation protein RepB PGA1:3.887..3.889 Mbp (1.317 kbp) score=10
PGA1_78p00020 ubiquinone biosynthesis protein PGA1:3.889..3.89 Mbp (1.419 kbp) score=10
oxyR hydrogen peroxide-inducible genes activator OxyR PGA1:3.892..3.893 Mbp (945 bp) score=10
PGA1_78p00060 hypothetical protein PGA1:3.895..3.896 Mbp (354 bp) score=10
PGA1_78p00080 hypothetical protein PGA1:3.896..3.897 Mbp (843 bp) score=10
PGA1_78p00090 HTH-type transcriptional regulator PGA1:3.897..3.898 Mbp (450 bp) score=10
hmp flavohemoprotein Hmp PGA1:3.898..3.899 Mbp (1.191 kbp) score=10
PGA1_78p00140 hypothetical protein PGA1:3.904..3.905 Mbp (1.056 kbp) score=10
PGA1_78p00150 HTH-type transcriptional regulator PGA1:3.905..3.906 Mbp (1.041 kbp) score=10
PGA1_78p00160 sugar-binding periplasmic protein PGA1:3.906..3.907 Mbp (1.23 kbp) score=10
ugpA sn-glycerol-3-phosphate transport system permease protein UgpA PGA1:3.908..3.908 Mbp (933 bp) score=10
ugpE sn-glycerol-3-phosphate transport system permease protein UgpE PGA1:3.908..3.909 Mbp (930 bp) score=10
ugpC sn-glycerol-3-phosphate import ATP-binding protein UgbC PGA1:3.909..3.91 Mbp (1.086 kbp) score=10
PGA1_78p00200 hypothetical protein PGA1:3.91..3.911 Mbp (744 bp) score=10
PGA1_78p00220 LysR family transcriptional regulator PGA1:3.912..3.913 Mbp (888 bp) score=10
PGA1_78p00240 hypothetical protein PGA1:3.915..3.917 Mbp (2.466 kbp) score=10
PGA1_78p00250 HTH-type transcriptional regulator PGA1:3.918..3.918 Mbp (612 bp) score=10
PGA1_78p00320 HTH-type transcriptional regulator PGA1:3.927..3.928 Mbp (1.044 kbp) score=10
PGA1_78p00330 transcriptional regulator PGA1:3.928..3.929 Mbp (633 bp) score=10
PGA1_78p00340 hypothetical protein PGA1:3.929..3.929 Mbp (492 bp) score=10
PGA1_78p00360 ferrichrome transport ATP-binding protein PGA1:3.931..3.931 Mbp (759 bp) score=10
PGA1_78p00390 periplasmic binding protein PGA1:3.933..3.934 Mbp (984 bp) score=10
PGA1_78p00410 siderophore biosynthesis protein PGA1:3.937..3.939 Mbp (1.833 kbp) score=10
PGA1_78p00420 siderophore biosynthesis protein PGA1:3.939..3.941 Mbp (1.749 kbp) score=10
PGA1_78p00440 hypothetical protein PGA1:3.942..3.943 Mbp (1.323 kbp) score=10
PGA1_78p00450 hypothetical protein PGA1:3.943..3.944 Mbp (867 bp) score=10
PGA1_78p00460 ABC transporter, transmembrane ATP-binding protein PGA1:3.944..3.946 Mbp (1.896 kbp) score=10
PGA1_78p00470 hypothetical protein PGA1:3.946..3.947 Mbp (300 bp) score=10
PGA1_78p00480 hypothetical protein PGA1:3.947..3.948 Mbp (1.086 kbp) score=10
PGA1_78p00490 HTH-type transcriptional regulator PGA1:3.948..3.949 Mbp (1.041 kbp) score=10
PGA1_78p00500 transcriptional regulator PGA1:3.949..3.95 Mbp (1.221 kbp) score=10
PGA1_78p00520 secretion protein, HylD family PGA1:3.954..3.955 Mbp (1.407 kbp) score=10
PGA1_78p00530 outer membrane protein PGA1:3.955..3.956 Mbp (753 bp) score=10
PGA1_78p00540 hypothetical protein PGA1:3.956..3.957 Mbp (753 bp) score=10
PGA1_78p00550 ArsR family transcriptional regulator PGA1:3.957..3.957 Mbp (363 bp) score=10
PGA1_78p00560 hypothetical protein PGA1:3.957..3.958 Mbp (414 bp) score=10
PGA1_78p00570 hypothetical protein PGA1:3.958..3.958 Mbp (930 bp) score=10
PGA1_78p00580 two-component system sensor-like protein PGA1:3.959..3.961 Mbp (2.028 kbp) score=10
PGA1_78p00590 hypothetical protein PGA1:3.961..3.962 Mbp (870 bp) score=10
PGA1_78p00610 plasmid partition protein A PGA1:3.963..3.965 Mbp (1.371 kbp) score=10
PGA1_262p00010 plasmid partition protein A PGA1:3.966..3.967 Mbp (1.305 kbp) score=10
PGA1_262p00030 hypothetical protein PGA1:3.968..3.97 Mbp (1.299 kbp) score=10
PGA1_262p00040 sulfotransferase-like protein PGA1:3.97..3.971 Mbp (915 bp) score=10
PGA1_262p00070 hypothetical protein PGA1:3.973..3.975 Mbp (1.287 kbp) score=10
PGA1_262p00080 hypothetical protein PGA1:3.975..3.976 Mbp (768 bp) score=10
PGA1_262p00090 exopolysaccharide biosynthesis transport protein PGA1:3.976..3.978 Mbp (2.112 kbp) score=10
exoL succinoglycan biosynthesis protein ExoL PGA1:3.98..3.981 Mbp (1.182 kbp) score=10
PGA1_262p00130 hypothetical protein PGA1:3.981..3.982 Mbp (1.065 kbp) score=10
PGA1_262p00140 amino acid binding protein PGA1:3.982..3.983 Mbp (1.161 kbp) score=10
PGA1_262p00150 methyl-accepting chemotaxis protein PGA1:3.983..3.986 Mbp (2.673 kbp) score=10
PGA1_262p00160 hypothetical protein PGA1:3.986..3.987 Mbp (300 bp) score=10
PGA1_262p00170 hypothetical protein PGA1:3.987..3.987 Mbp (717 bp) score=10
PGA1_262p00180 AsnC family transcriptional regulator PGA1:3.987..3.988 Mbp (474 bp) score=10
PGA1_262p00200 LysR family transcriptional regulator PGA1:3.989..3.99 Mbp (927 bp) score=10
PGA1_262p00240 hypothetical protein PGA1:3.995..3.995 Mbp (246 bp) score=10
PGA1_262p00250 ferritin-like protein PGA1:3.995..3.995 Mbp (474 bp) score=10
PGA1_262p00260 hypothetical protein PGA1:3.996..3.996 Mbp (441 bp) score=10
PGA1_262p00270 GntR family transcriptional regulator PGA1:3.996..3.997 Mbp (669 bp) score=10
PGA1_262p00290 transcriptional regulator PGA1:3.998..3.999 Mbp (612 bp) score=10
PGA1_262p00300 ABC transporter, extracellular solute-binding protein PGA1:3.999..4 Mbp (1.587 kbp) score=10
PGA1_262p00330 oligopeptide ABC transporter, ATP binding protein PGA1:4.002..4.003 Mbp (999 bp) score=10
PGA1_262p00340 oligopeptide ABC transporter, ATP binding protein PGA1:4.003..4.004 Mbp (999 bp) score=10
PGA1_262p00360 methyl-accepting chemotaxis protein PGA1:4.006..4.008 Mbp (2.151 kbp) score=10
PGA1_262p00410 hypothetical protein PGA1:4.014..4.016 Mbp (1.557 kbp) score=10
PGA1_262p00420 hypothetical protein PGA1:4.016..4.017 Mbp (1.215 kbp) score=10
xylF D-xylose-binding periplasmic protein XylF PGA1:4.017..4.018 Mbp (1.026 kbp) score=10
xylH xylose transport system permease protein XylH PGA1:4.018..4.02 Mbp (1.302 kbp) score=10
PGA1_262p00450 sugar ABC transporter ATP-binding protein PGA1:4.02..4.021 Mbp (783 bp) score=10
PGA1_262p00460 MerR family transcriptional regulator PGA1:4.021..4.021 Mbp (429 bp) score=10
PGA1_262p00470 hypothetical protein PGA1:4.021..4.021 Mbp (369 bp) score=10
PGA1_262p00480 hypothetical protein PGA1:4.021..4.022 Mbp (276 bp) score=10
PGA1_262p00490 hypothetical protein PGA1:4.022..4.022 Mbp (723 bp) score=10
PGA1_262p00510 hypothetical protein PGA1:4.024..4.025 Mbp (1.014 kbp) score=10
PGA1_262p00520 multi antimicrobial extrusion protein PGA1:4.025..4.027 Mbp (1.335 kbp) score=10
PGA1_262p00530 DNA topoisomerase 1B-like protein PGA1:4.027..4.028 Mbp (978 bp) score=10
PGA1_262p00550 hypothetical protein PGA1:4.029..4.03 Mbp (1.257 kbp) score=10
PGA1_262p00560 uracil DNA glycosylase-like protein PGA1:4.03..4.032 Mbp (1.446 kbp) score=10
PGA1_262p00570 hypothetical protein PGA1:4.032..4.032 Mbp (258 bp) score=10
PGA1_262p00580 polysaccharide biosynthesis/export protein PGA1:4.032..4.034 Mbp (1.374 kbp) score=10
PGA1_262p00590 hypothetical protein PGA1:4.034..4.034 Mbp (660 bp) score=10
PGA1_262p00600 hypothetical protein PGA1:4.034..4.036 Mbp (2.13 kbp) score=10
PGA1_262p00620 hypothetical protein PGA1:4.037..4.038 Mbp (654 bp) score=10
PGA1_262p00630 hypothetical protein PGA1:4.038..4.039 Mbp (1.05 kbp) score=10
PGA1_262p00640 hypothetical protein PGA1:4.04..4.041 Mbp (1.08 kbp) score=10
PGA1_262p00660 hypothetical protein PGA1:4.042..4.043 Mbp (822 bp) score=10
PGA1_262p00670 hypothetical protein PGA1:4.043..4.044 Mbp (1.347 kbp) score=10
PGA1_262p00680 hypothetical protein PGA1:4.044..4.045 Mbp (555 bp) score=10
PGA1_262p00750 hypothetical protein PGA1:4.05..4.051 Mbp (1.026 kbp) score=10
PGA1_262p00760 AsnC family transcriptional regulator PGA1:4.051..4.051 Mbp (474 bp) score=10
PGA1_262p00790 hypothetical protein PGA1:4.054..4.054 Mbp (132 bp) score=10
tdaF flavoprotein, HFCD family PGA1:4.056..4.057 Mbp (570 bp) score=10
PGA1_262p00820 hypothetical protein PGA1:4.057..4.057 Mbp (441 bp) score=10
PGA1_262p00830 hypothetical protein PGA1:4.057..4.059 Mbp (1.062 kbp) score=10
PGA1_262p00840 hypothetical protein PGA1:4.059..4.06 Mbp (1.326 kbp) score=10
PGA1_262p00860 hypothetical protein PGA1:4.062..4.062 Mbp (459 bp) score=10
PGA1_262p00870 ABC transporter, extracellular solute-binding protein PGA1:4.062..4.064 Mbp (1.602 kbp) score=10
PGA1_262p00900 ABC transporter ATP-binding protein PGA1:4.066..4.067 Mbp (1.497 kbp) score=10
PGA1_262p00910 cation transort protein PGA1:4.067..4.068 Mbp (558 bp) score=10
PGA1_262p00920 hypothetical protein PGA1:4.068..4.069 Mbp (687 bp) score=10
PGA1_262p00930 hypothetical protein PGA1:4.069..4.069 Mbp (582 bp) score=10
tdaD thioesterase superfamily protein TdaD PGA1:4.07..4.071 Mbp (417 bp) score=10
tdaC prephenate dehydratase TdaC-like protein PGA1:4.071..4.072 Mbp (603 bp) score=10
tdaA LysR family transcriptional regulator PGA1:4.073..4.074 Mbp (891 bp) score=10
PGA1_262p00990 LysR family transcriptional regulator PGA1:4.074..4.075 Mbp (924 bp) score=10
dppD dipeptide transport ATP-binding protein DppD PGA1:4.076..4.077 Mbp (993 bp) score=10
dppA periplasmic dipeptide transport protein DppA PGA1:4.079..4.081 Mbp (1.557 kbp) score=10
PGA1_262p01050 hypothetical protein PGA1:4.081..4.082 Mbp (924 bp) score=10
PGA1_262p01060 hypothetical protein PGA1:4.082..4.083 Mbp (489 bp) score=10
PGA1_262p01110 hypothetical protein PGA1:4.086..4.086 Mbp (426 bp) score=10
PGA1_262p01120 hypothetical protein PGA1:4.086..4.087 Mbp (399 bp) score=10
PGA1_262p01130 hypothetical protein PGA1:4.087..4.087 Mbp (666 bp) score=10
PGA1_262p01140 hypothetical protein PGA1:4.088..4.093 Mbp (5.178 kbp) score=10
PGA1_262p01150 hypothetical protein PGA1:4.093..4.093 Mbp (195 bp) score=10
PGA1_262p01160 hypothetical protein PGA1:4.093..4.095 Mbp (1.389 kbp) score=10
PGA1_262p01165 hypothetical protein PGA1:4.095..4.095 Mbp (381 bp) score=10
PGA1_262p01170 nnrS protein PGA1:4.095..4.096 Mbp (1.224 kbp) score=10
PGA1_262p01180 hypothetical protein PGA1:4.096..4.097 Mbp (222 bp) score=10
PGA1_262p01190 hypothetical protein PGA1:4.097..4.097 Mbp (183 bp) score=10
norD protein NorD PGA1:4.097..4.099 Mbp (1.938 kbp) score=10
norQ protein NorQ PGA1:4.099..4.1 Mbp (795 bp) score=10
PGA1_262p01240 hypothetical protein PGA1:4.101..4.102 Mbp (228 bp) score=10
PGA1_262p01250 transcriptional regulator, crp family PGA1:4.102..4.103 Mbp (705 bp) score=10
PGA1_262p01270 hypothetical protein PGA1:4.104..4.105 Mbp (759 bp) score=10
PGA1_262p01280 TetR family transcriptional regulator PGA1:4.105..4.105 Mbp (609 bp) score=10
PGA1_262p01290 AraC family transcriptional regulator PGA1:4.105..4.106 Mbp (1.008 kbp) score=10
PGA1_262p01300 hypothetical protein PGA1:4.107..4.107 Mbp (441 bp) score=10
PGA1_262p01320 hypothetical protein PGA1:4.109..4.109 Mbp (702 bp) score=10
PGA1_262p01330 MarR family transcriptional regulator PGA1:4.109..4.11 Mbp (558 bp) score=10
PGA1_262p01340 hypothetical protein PGA1:4.11..4.111 Mbp (750 bp) score=10
PGA1_262p01360 LysR family transcriptional regulator PGA1:4.112..4.113 Mbp (942 bp) score=10
PGA1_262p01390 hypothetical protein PGA1:4.116..4.116 Mbp (240 bp) score=10
PGA1_262p01410 malate/L-lactate dehydrogenase-like protein PGA1:4.118..4.119 Mbp (438 bp) score=10
PGA1_262p01420 hypothetical protein PGA1:4.12..4.12 Mbp (651 bp) score=10
PGA1_262p01430 hypothetical protein PGA1:4.12..4.122 Mbp (1.692 kbp) score=10
PGA1_262p01470 LysR family transcriptional regulator PGA1:4.126..4.127 Mbp (897 bp) score=10
PGA1_262p01480 AraC family transcriptional regulator PGA1:4.127..4.128 Mbp (1.008 kbp) score=10
PGA1_262p01530 GntR family transcriptional regulator PGA1:4.133..4.135 Mbp (1.47 kbp) score=10
PGA1_262p01560 AraC family transcriptional regulator PGA1:4.138..4.139 Mbp (1.026 kbp) score=10
PGA1_262p01570 hypothetical protein PGA1:4.139..4.141 Mbp (2.223 kbp) score=10
PGA1_262p01590 hypothetical protein PGA1:4.142..4.142 Mbp (672 bp) score=10
PGA1_262p01600 ABC transporter, ATP binding protein PGA1:4.142..4.143 Mbp (696 bp) score=10
PGA1_262p01620 hypothetical protein PGA1:4.144..4.145 Mbp (501 bp) score=10
PGA1_262p01630 hypothetical protein PGA1:4.145..4.145 Mbp (246 bp) score=10
PGA1_262p01640 hypothetical protein PGA1:4.145..4.146 Mbp (237 bp) score=10
PGA1_262p01650 insertion sequence ATP binding protein PGA1:4.146..4.146 Mbp (732 bp) score=10
PGA1_262p01670 LysR family transcriptional regulator PGA1:4.148..4.149 Mbp (879 bp) score=10
PGA1_262p01680 hypothetical protein PGA1:4.149..4.15 Mbp (789 bp) score=10
PGA1_262p01700 ABC transporter, solute-binding protein PGA1:4.152..4.153 Mbp (1.551 kbp) score=10
PGA1_262p01710 glutathione transport system permease protein PGA1:4.153..4.154 Mbp (939 bp) score=10
PGA1_262p01720 glutathione transport system permease protein PGA1:4.154..4.155 Mbp (879 bp) score=10
PGA1_262p01730 glutathione import ATP-binding protein PGA1:4.155..4.156 Mbp (978 bp) score=10
PGA1_262p01740 peptide ABC transporter ATP-binding protein PGA1:4.156..4.157 Mbp (930 bp) score=10
PGA1_262p01780 LysR family transcriptional regulator PGA1:4.161..4.161 Mbp (906 bp) score=10
PGA1_262p01810 hypothetical protein PGA1:4.164..4.166 Mbp (1.704 kbp) score=10
PGA1_262p01820 hypothetical protein PGA1:4.166..4.166 Mbp (651 bp) score=10
PGA1_262p01870 AraC family transcriptional regulator PGA1:4.172..4.173 Mbp (1.02 kbp) score=10
PGA1_262p01880 mandelate racemase/ muconate lactonizing enzyme-like protein PGA1:4.174..4.175 Mbp (1.194 kbp) score=10
PGA1_262p01890 hypothetical protein PGA1:4.175..4.175 Mbp (312 bp) score=10
PGA1_262p01900 hypothetical protein PGA1:4.175..4.176 Mbp (438 bp) score=10
PGA1_262p01930 ArsR family transcriptional regulator PGA1:4.178..4.179 Mbp (336 bp) score=10
PGA1_262p01940 hypothetical protein PGA1:4.179..4.179 Mbp (567 bp) score=10
PGA1_262p01950 TetR family transcriptional regulator PGA1:4.18..4.18 Mbp (573 bp) score=10
PGA1_262p01960 hypothetical protein PGA1:4.181..4.181 Mbp (753 bp) score=10
PGA1_262p01970 TetR family transcriptional regulator PGA1:4.182..4.182 Mbp (609 bp) score=10
PGA1_262p01990 hypothetical protein PGA1:4.183..4.184 Mbp (1.023 kbp) score=10
PGA1_262p02000 LysR family transcriptional regulator PGA1:4.184..4.185 Mbp (858 bp) score=10
PGA1_262p02010 hypothetical protein PGA1:4.185..4.186 Mbp (249 bp) score=10
PGA1_262p02030 insertion sequence ATP binding protein PGA1:4.187..4.188 Mbp (732 bp) score=10
PGA1_262p02040 MerR family transcriptional regulator PGA1:4.188..4.188 Mbp (144 bp) score=10
PGA1_262p02070 hypothetical protein PGA1:4.191..4.191 Mbp (279 bp) score=10
PGA1_262p02080 hypothetical protein PGA1:4.192..4.192 Mbp (345 bp) score=10
PGA1_262p02090 response regulator receiver domain-containing protein PGA1:4.192..4.192 Mbp (387 bp) score=10
cheW chemotaxis protein CheW PGA1:4.193..4.194 Mbp (489 bp) score=10
cheA chemotaxis protein CheA PGA1:4.194..4.196 Mbp (2.136 kbp) score=10
PGA1_262p02140 hypothetical protein PGA1:4.196..4.197 Mbp (405 bp) score=10
cheD1 methyl-accepting chemotaxis protein I PGA1:4.197..4.199 Mbp (2.4 kbp) score=10
PGA1_262p02160 chemotaxis response regulator protein-glutamate methylesterase PGA1:4.199..4.2 Mbp (1.005 kbp) score=10
cheD2 chemotaxis protein CheD PGA1:4.2..4.201 Mbp (555 bp) score=10
modA molybdate-binding periplasmic protein ModA PGA1:4.201..4.202 Mbp (816 bp) score=10
modB molybdenum transport system permease protein ModB PGA1:4.202..4.203 Mbp (699 bp) score=10
modC molybdenum import ATP-binding protein ModC PGA1:4.203..4.204 Mbp (1.092 kbp) score=10
PGA1_262p02220 ABC transporter substrate-binding protein PGA1:4.205..4.206 Mbp (1.071 kbp) score=10
znuC zinc import ATP-binding protein ZnuC PGA1:4.207..4.208 Mbp (777 bp) score=10
znuB high-affinity zinc uptake system membrane protein ZnuB PGA1:4.208..4.208 Mbp (798 bp) score=10
PGA1_262p02260 two-component sensor histidine kinase/response regulator hybrid protein PGA1:4.209..4.211 Mbp (2.28 kbp) score=10
PGA1_262p02270 hypothetical protein PGA1:4.211..4.212 Mbp (933 bp) score=10
PGA1_262p02280 hypothetical protein PGA1:4.212..4.216 Mbp (4.026 kbp) score=10
PGA1_262p02340 TetR family transcriptional regulator PGA1:4.222..4.223 Mbp (648 bp) score=10
hisP histidine transport ATP-binding protein HisP PGA1:4.223..4.224 Mbp (846 bp) score=10
PGA1_262p02360 histidine-binding periplasmic protein PGA1:4.224..4.225 Mbp (780 bp) score=10
hisQ histidine transport system permease protein HisQ PGA1:4.225..4.225 Mbp (753 bp) score=10
hisM histidine transport system permease protein HisM PGA1:4.225..4.226 Mbp (777 bp) score=10
PGA1_262p02390 hypothetical protein PGA1:4.226..4.227 Mbp (696 bp) score=10
PGA1_262p02400 hypothetical protein PGA1:4.227..4.227 Mbp (201 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70