Roseobase: Rhodobacterales bacterium HTCC2255

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: OM2255:100000..200000, OM2255_02812, tolB, OM2255_r10505, OM2255_t07435, ZP_01448439, transcriptional regulator, MLSIFITVLPVFLIIATGYIVMWRKLMSESSIDALALFAQKYAIPCLLFLAVANLDLKEY.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 113 regions match your request.
Matches on OM2255
overview_OM2255
OM2255_02912 COG1802 Transcriptional regulators transcriptional regulator (activator) protein, AsnC/GntR family OM2255:19.43..20.09 kbp (657 bp) score=40
OM2255_03027 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:40.94..41.86 kbp (918 bp) score=40
OM2255_03332 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein OM2255:105.1..105.5 kbp (423 bp) score=40
OM2255_03850 COG1959 Predicted transcriptional regulator Rrf2 family transcriptional regulator OM2255:223.5..223.9 kbp (462 bp) score=40
OM2255_03925 COG2188 Transcriptional regulators transcriptional regulator, GntR family protein OM2255:237.9..238.6 kbp (711 bp) score=40
OM2255_04010 COG1609 Transcriptional regulators transcriptional regulatory protein OM2255:258.5..259.6 kbp (1.026 kbp) score=40
OM2255_04180 COG1609 Transcriptional regulators transcriptional regulator, LacI family protein OM2255:295.9..296.9 kbp (1.005 kbp) score=40
OM2255_04255 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:311.2..312.1 kbp (912 bp) score=40
OM2255_04390 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein OM2255:338.4..338.8 kbp (462 bp) score=40
OM2255_04445 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:346.2..347.1 kbp (900 bp) score=40
OM2255_04720 COG0583 Transcriptional regulator transcriptional regulator OM2255:398.1..399 kbp (840 bp) score=40
OM2255_04990 COG1309 Transcriptional regulator Transcriptional regulator, TetR family protein OM2255:457.5..458.1 kbp (639 bp) score=40
OM2255_04995 COG1309 Transcriptional regulator probable transcriptional regulator OM2255:458.2..458.8 kbp (624 bp) score=40
OM2255_05100 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:477.6..478.5 kbp (900 bp) score=40
OM2255_05440 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein OM2255:554..554.4 kbp (480 bp) score=40
OM2255_05485 COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs transcriptional regulator, GntR family protein OM2255:563.6..565.1 kbp (1.464 kbp) score=40
OM2255_05750 COG0583 Transcriptional regulator putative transcriptional regulatory protein (LysR family) OM2255:615.7..616.6 kbp (921 bp) score=40
OM2255_05770 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:619.2..620.1 kbp (873 bp) score=40
OM2255_05780 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:621.7..622.6 kbp (870 bp) score=40
OM2255_05840 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein OM2255:632.5..633.1 kbp (666 bp) score=40
OM2255_05865 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:637.4..638.3 kbp (933 bp) score=40
OM2255_05985 COG1414 Transcriptional regulator transcriptional regulator, IclR family protein OM2255:668.9..669.6 kbp (771 bp) score=40
OM2255_06170 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein OM2255:710.8..711.4 kbp (642 bp) score=40
OM2255_06285 COG0583 Transcriptional regulator transcriptional regulator MetR OM2255:732.8..733.7 kbp (891 bp) score=40
OM2255_06405 COG1522 Transcriptional regulators transcriptional regulator OM2255:758.7..759.2 kbp (486 bp) score=40
OM2255_06445 COG1329 Transcriptional regulators, similar to M. xanthus CarD transcriptional regulator, CarD family protein OM2255:765.8..766.3 kbp (513 bp) score=40
OM2255_06690 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein OM2255:813.7..814.6 kbp (972 bp) score=40
OM2255_06910 COG0583 Transcriptional regulator putative transcriptional regulator, lysR family protein OM2255:860.9..861.8 kbp (912 bp) score=40
OM2255_07135 COG1609 Transcriptional regulators transcriptional regulator OM2255:903.9..904.9 kbp (1.02 kbp) score=40
OM2255_07375 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein OM2255:959.4..959.8 kbp (393 bp) score=40
OM2255_07470 COG0789 Predicted transcriptional regulators copper eflux transcriptional regulator protein, MerR family OM2255:972.7..973.1 kbp (387 bp) score=40
OM2255_07660 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:1.011..1.012 Mbp (885 bp) score=40
OM2255_07665 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein OM2255:1.012..1.013 Mbp (954 bp) score=40
OM2255_08105 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein OM2255:1.092..1.092 Mbp (459 bp) score=40
OM2255_08626 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein OM2255:1.21..1.211 Mbp (957 bp) score=40
OM2255_09251 COG1846 Transcriptional regulators transcriptional regulator, putative OM2255:1.347..1.347 Mbp (441 bp) score=40
OM2255_09311 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:1.358..1.359 Mbp (912 bp) score=40
OM2255_09821 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein OM2255:1.459..1.459 Mbp (504 bp) score=40
OM2255_10006 COG1609 Transcriptional regulators transcriptional regulator OM2255:1.494..1.495 Mbp (1.002 kbp) score=40
OM2255_10111 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:1.515..1.516 Mbp (882 bp) score=40
OM2255_10121 COG1414 Transcriptional regulator transcriptional regulator, IclR family protein OM2255:1.517..1.518 Mbp (825 bp) score=40
OM2255_10146 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:1.523..1.524 Mbp (888 bp) score=40
OM2255_10346 COG0640 Predicted transcriptional regulators transcriptional regulator, ArsR family protein OM2255:1.563..1.563 Mbp (330 bp) score=40
OM2255_11425 COG0583 Transcriptional regulator transcriptional regulator OM2255:1.767..1.768 Mbp (873 bp) score=40
OM2255_11620 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein OM2255:1.802..1.802 Mbp (483 bp) score=40
OM2255_11925 COG1396 Predicted transcriptional regulators transcriptional regulator, putative OM2255:1.858..1.859 Mbp (1.299 kbp) score=40
OM2255_12702 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein OM2255:2.019..2.02 Mbp (525 bp) score=40
OM2255_12862 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor Putative transcriptional regulator OM2255:2.048..2.049 Mbp (768 bp) score=40
OM2255_13639 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein OM2255:2.121..2.122 Mbp (651 bp) score=40
OM2255_13619 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein OM2255:2.125..2.125 Mbp (456 bp) score=40
OM2255_13614 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein OM2255:2.125..2.126 Mbp (462 bp) score=40
OM2255_13434 COG0583 Transcriptional regulator Transcriptional regulator, LysR family protein OM2255:2.166..2.167 Mbp (969 bp) score=40
OM2255_13369 COG1802 Transcriptional regulators GntR family transcriptional regulator OM2255:2.178..2.179 Mbp (690 bp) score=40
OM2255_13194 COG0640 Predicted transcriptional regulators transcriptional regulator SoxR OM2255:2.213..2.213 Mbp (333 bp) score=40
OM2255_04100 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains two component, sigma54 specific transcriptional regulator, fis family protein OM2255:277.1..278.4 kbp (1.344 kbp) score=30
OM2255_04265 COG1522 Transcriptional regulators Bacterial regulatory protein, AsnC family:Helix-turn-helix, Fis-type OM2255:312.4..312.9 kbp (471 bp) score=30
OM2255_04795 COG1802 Transcriptional regulators regulatory protein GntR, HTH:GntR, C-terminal OM2255:414.8..415.5 kbp (702 bp) score=30
OM2255_05700 COG1940 Transcriptional regulator/sugar kinase putative transcription regulator protein OM2255:607..608.2 kbp (1.209 kbp) score=30
OM2255_07005 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcription regulator OM2255:881.9..882.9 kbp (999 bp) score=30
OM2255_07345 COG0583 Transcriptional regulator probable LysR-family transcriptional activator OM2255:954..954.9 kbp (885 bp) score=30
OM2255_07640 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains C4-dicarboxylate transport transcriptional regulatory protein OM2255:1.007..1.008 Mbp (1.215 kbp) score=30
OM2255_09736 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain two-component transcriptional regulator, winged helix family protein OM2255:1.443..1.443 Mbp (681 bp) score=30
OM2255_09826 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain two component transcriptional regulator, winged helix family protein OM2255:1.459..1.46 Mbp (708 bp) score=30
OM2255_09976 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain two-component transcriptional regulator ChvI, winged helix family protein OM2255:1.487..1.488 Mbp (684 bp) score=30
OM2255_11230 COG1522 Transcriptional regulators Proline dehydrogenase transcriptional activator OM2255:1.73..1.73 Mbp (477 bp) score=30
OM2255_11740 COG1802 Transcriptional regulators regulatory protein GntR, HTH:GntR, C-terminal OM2255:1.821..1.821 Mbp (306 bp) score=30
OM2255_03367 COG0347 Nitrogen regulatory protein PII nitrogen regulatory protein P-II OM2255:113.5..113.8 kbp (339 bp) score=20
OM2255_03552 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains Response regulator containing CheY-like receiver OM2255:156.1..157.4 kbp (1.398 kbp) score=20
OM2255_03562 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains nitrogen assimilation regulatory protein NtrX OM2255:159.8..161.2 kbp (1.41 kbp) score=20
OM2255_03950 COG1522 Transcriptional regulators OM2255:243..243.5 kbp (435 bp) score=20
OM2255_04825 COG1349 Transcriptional regulators of sugar metabolism OM2255:421.8..422.6 kbp (765 bp) score=20
OM2255_04930 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator OM2255:445.5..446.2 kbp (654 bp) score=20
OM2255_05060 COG1349 Transcriptional regulators of sugar metabolism OM2255:469.7..470.4 kbp (774 bp) score=20
OM2255_05185 COG1940 Transcriptional regulator/sugar kinase OM2255:495.8..497.1 kbp (1.266 kbp) score=20
OM2255_05325 COG1396 Predicted transcriptional regulators OM2255:525.5..526.2 kbp (606 bp) score=20
OM2255_05530 COG1309 Transcriptional regulator OM2255:574.2..574.9 kbp (630 bp) score=20
OM2255_05625 COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain DNA-binding response regulator, LuxR family protein OM2255:593.3..593.9 kbp (618 bp) score=20
OM2255_06640 transcriptional regulator, Fur family protein OM2255:805.2..805.6 kbp (411 bp) score=20
OM2255_06935 COG1396 Predicted transcriptional regulators OM2255:866.5..867.1 kbp (621 bp) score=20
OM2255_07210 COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain DNA-binding response regulator, LuxR family protein OM2255:918.6..919.3 kbp (669 bp) score=20
OM2255_07250 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain Response regulator OM2255:929.5..930.1 kbp (588 bp) score=20
OM2255_08210 COG1678 Putative transcriptional regulator OM2255:1.108..1.109 Mbp (567 bp) score=20
OM2255_08641 COG1396 Predicted transcriptional regulators OM2255:1.215..1.215 Mbp (573 bp) score=20
OM2255_08716 COG0347 Nitrogen regulatory protein PII nitrogen regulatory protein P-II OM2255:1.228..1.229 Mbp (339 bp) score=20
OM2255_08976 COG1846 Transcriptional regulators OM2255:1.286..1.286 Mbp (366 bp) score=20
OM2255_09131 COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain photosynthetic apparatus regulatory protein RegA OM2255:1.316..1.316 Mbp (561 bp) score=20
OM2255_09421 COG1475 Predicted transcriptional regulators OM2255:1.379..1.38 Mbp (885 bp) score=20
OM2255_09451 COG1420 Transcriptional regulator of heat shock gene OM2255:1.384..1.385 Mbp (1.059 kbp) score=20
OM2255_10376 COG2186 Transcriptional regulators OM2255:1.566..1.567 Mbp (768 bp) score=20
OM2255_11000 transcriptional regulator, Fur family protein OM2255:1.68..1.68 Mbp (417 bp) score=20
OM2255_11350 COG1396 Predicted transcriptional regulators OM2255:1.753..1.754 Mbp (276 bp) score=20
OM2255_11495 COG1733 Predicted transcriptional regulators OM2255:1.781..1.781 Mbp (474 bp) score=20
OM2255_11735 COG1802 Transcriptional regulators OM2255:1.821..1.821 Mbp (171 bp) score=20
OM2255_11780 transcriptional regulator OM2255:1.828..1.83 Mbp (1.896 kbp) score=20
OM2255_11900 COG1396 Predicted transcriptional regulators OM2255:1.852..1.854 Mbp (1.407 kbp) score=20
OM2255_11920 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain Response regulator OM2255:1.857..1.858 Mbp (369 bp) score=20
OM2255_12692 COG1386 Predicted transcriptional regulator containing the HTH domain OM2255:2.017..2.018 Mbp (645 bp) score=20
OM2255_13689 COG1396 Predicted transcriptional regulators OM2255:2.111..2.112 Mbp (846 bp) score=20
OM2255_13179 COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains OM2255:2.216..2.216 Mbp (465 bp) score=20
OM2255_03287 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) OM2255:94.83..95.52 kbp (687 bp) score=10
OM2255_04140 COG0440 Acetolactate synthase, small (regulatory) subunit OM2255:285.7..286.2 kbp (561 bp) score=10
OM2255_04440 COG0425 Predicted redox protein, regulator of disulfide bond formation OM2255:345.9..346.1 kbp (228 bp) score=10
OM2255_05620 sensory box histidine kinase/response regulator OM2255:590.4..592.9 kbp (2.532 kbp) score=10
OM2255_06085 sulfur deprivation response regulator OM2255:691..692.9 kbp (1.884 kbp) score=10
OM2255_06415 COG1764 Predicted redox protein, regulator of disulfide bond formation OM2255:760.5..761 kbp (453 bp) score=10
OM2255_07255 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain OM2255:930.1..930.2 kbp (129 bp) score=10
OM2255_08536 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) OM2255:1.183..1.185 Mbp (1.944 kbp) score=10
OM2255_08981 transcriptional antitermination protein, putative OM2255:1.286..1.287 Mbp (501 bp) score=10
OM2255_09136 regulatory protein SenC OM2255:1.316..1.317 Mbp (600 bp) score=10
OM2255_09496 PTS IIA-like nitrogen-regulatory protein PtsN OM2255:1.394..1.395 Mbp (465 bp) score=10
OM2255_11160 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain OM2255:1.714..1.715 Mbp (684 bp) score=10
OM2255_12190 ATP phosphoribosyltransferase regulatory subunit OM2255:1.917..1.918 Mbp (1.086 kbp) score=10
OM2255_12412 COG3023 Negative regulator of beta-lactamase expression OM2255:1.955..1.956 Mbp (717 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70