Roseobase: Oceanicola granulosus HTCC2516

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: OG2516:300000..400000, OG2516_19065, OG2516_t06551, OG2516_r00284, argJ, ZP_01157098, translation initiation factor, MPNKLLLRALAGETLPTPPIWLMRQAGRYLPE.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 86 regions match your request.
Matches on OG2516
overview_OG2516
OG2516_00724 COG0182 Predicted translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family probable translation initiation factor eIF-2B alpha subunit OG2516:163.4..164.5 kbp (1.065 kbp) score=60
OG2516_01129 COG0290 Translation initiation factor 3 (IF-3) translation initiation factor OG2516:250.4..250.8 kbp (411 bp) score=60
OG2516_10361 COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) elongation factor P OG2516:2.109..2.11 Mbp (567 bp) score=60
infB COG0532 Translation initiation factor 2 (IF-2; GTPase) translation initiation factor IF-2 OG2516:2.392..2.394 Mbp (2.427 kbp) score=60
OG2516_13024 COG0182 Predicted translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family translation initiation factor IF-2B subunit alpha OG2516:2.756..2.757 Mbp (1.089 kbp) score=60
OG2516_17418 COG0361 Translation initiation factor 1 (IF-1) translation initiation factor IF-1 OG2516:3.669..3.67 Mbp (219 bp) score=60
OG2516_00799 COG0251 Putative translation initiation inhibitor, yjgF family translation initiation inhibitor, putative OG2516:182.6..183 kbp (399 bp) score=40
OG2516_08501 COG0050 GTPases - translation elongation factors translation elongation factor Tu OG2516:1.763..1.765 Mbp (1.176 kbp) score=40
OG2516_08603 COG0050 GTPases - translation elongation factors translation elongation factor Tu OG2516:1.786..1.787 Mbp (1.176 kbp) score=40
tsf COG0264 Translation elongation factor Ts elongation factor Ts OG2516:439.3..440.2 kbp (858 bp) score=30
OG2516_08506 COG0480 Translation elongation factors (GTPases) Elongation factor G OG2516:1.765..1.767 Mbp (2.142 kbp) score=30
OG2516_11181 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) OG2516:2.29..2.291 Mbp (672 bp) score=30
OG2516_17730 COG0251 Putative translation initiation inhibitor, yjgF family conserved hypothetical translation inhibitor protein OG2516:3.719..3.719 Mbp (378 bp) score=30
OG2516_01199 COG2896 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein A OG2516:261.9..262.9 kbp (1.005 kbp) score=20
OG2516_01964 COG0233 Ribosome recycling factor ribosome recycling factor OG2516:403..403.6 kbp (561 bp) score=20
OG2516_02359 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain von Willebrand factor type A domain protein OG2516:472.4..475.6 kbp (3.198 kbp) score=20
OG2516_02484 COG1197 Transcription-repair coupling factor (superfamily II helicase) transcription-repair coupling factor OG2516:506.2..509.6 kbp (3.456 kbp) score=20
OG2516_02594 COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) trigger factor OG2516:531.9..533.3 kbp (1.338 kbp) score=20
OG2516_02818 COG4108 Peptide chain release factor RF-3 peptide chain release factor 3 OG2516:582.4..584 kbp (1.596 kbp) score=20
OG2516_03208 COG0315 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein C OG2516:660.1..660.5 kbp (474 bp) score=20
OG2516_03493 COG0216 Protein chain release factor A peptide chain release factor 1 OG2516:714.3..715.3 kbp (1.056 kbp) score=20
OG2516_03805 COG1186 Protein chain release factor B peptide chain release factor 2 OG2516:745.8..746.9 kbp (1.125 kbp) score=20
OG2516_05773 COG0781 Transcription termination factor transcription antitermination factor NusB OG2516:1.215..1.215 Mbp (471 bp) score=20
OG2516_08903 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family xanthine dehydrogenase accessory factor OG2516:1.848..1.848 Mbp (744 bp) score=20
dnaA COG0593 ATPase involved in DNA replication initiation chromosomal replication initiation protein OG2516:2.068..2.069 Mbp (1.359 kbp) score=20
OG2516_10231 COG0858 Ribosome-binding factor A ribosome-binding factor A OG2516:2.083..2.083 Mbp (432 bp) score=20
OG2516_10306 COG3806 Anti-sigma factor Anti-sigma factor ChrR OG2516:2.096..2.097 Mbp (654 bp) score=20
OG2516_10686 COG0480 Translation elongation factors (GTPases) OG2516:2.177..2.178 Mbp (534 bp) score=20
OG2516_11301 COG1158 Transcription termination factor transcription termination factor Rho OG2516:2.316..2.317 Mbp (1.272 kbp) score=20
OG2516_11581 COG0195 Transcription elongation factor transcription elongation factor NusA OG2516:2.39..2.391 Mbp (1.629 kbp) score=20
OG2516_12396 COG0251 Putative translation initiation inhibitor, yjgF family OG2516:2.551..2.551 Mbp (465 bp) score=20
OG2516_12734 COG0251 Putative translation initiation inhibitor, yjgF family OG2516:2.615..2.616 Mbp (465 bp) score=20
OG2516_14790 COG0012 Predicted GTPase, probable translation factor OG2516:3.1..3.101 Mbp (1.086 kbp) score=20
OG2516_16546 COG1977 Molybdopterin converting factor, small subunit putative molybdopterin MPT converting factor, subunit 1 protein OG2516:3.486..3.486 Mbp (249 bp) score=20
OG2516_16551 COG0314 Molybdopterin converting factor, large subunit Molybdopterin converting factor subunit 2 OG2516:3.486..3.487 Mbp (441 bp) score=20
OG2516_16621 COG0782 Transcription elongation factor transcription elongation factor GreA OG2516:3.499..3.499 Mbp (471 bp) score=20
OG2516_16666 COG0009 Putative translation factor (SUA5) OG2516:3.507..3.508 Mbp (954 bp) score=20
OG2516_16961 COG0728 Uncharacterized membrane protein, putative virulence factor putative virulence factor, MviN OG2516:3.565..3.567 Mbp (1.551 kbp) score=20
OG2516_18000 COG0251 Putative translation initiation inhibitor, yjgF family OG2516:3.775..3.775 Mbp (363 bp) score=20
OG2516_18525 COG0251 Putative translation initiation inhibitor, yjgF family OG2516:3.924..3.924 Mbp (396 bp) score=20
OG2516_00175 integration host factor, alpha subunit OG2516:45.36..45.66 kbp (306 bp) score=10
OG2516_00759 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain OG2516:171.4..172.4 kbp (975 bp) score=10
OG2516_01134 COG5271 AAA ATPase containing von Willebrand factor type A (vWA) domain OG2516:251.2..252.3 kbp (1.041 kbp) score=10
OG2516_01326 COG1138 Cytochrome c biogenesis factor OG2516:283.1..285.1 kbp (1.974 kbp) score=10
OG2516_01421 COG0728 Uncharacterized membrane protein, putative virulence factor OG2516:300.5..301.4 kbp (897 bp) score=10
OG2516_01909 COG1923 Uncharacterized host factor I protein OG2516:391.5..391.7 kbp (234 bp) score=10
tig trigger factor OG2516:530.5..531.2 kbp (684 bp) score=10
OG2516_02624 COG4235 Cytochrome c biogenesis factor OG2516:539.4..540.6 kbp (1.209 kbp) score=10
OG2516_02718 COG0593 ATPase involved in DNA replication initiation OG2516:558.5..559.2 kbp (672 bp) score=10
OG2516_02758 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation OG2516:569.3..570.6 kbp (1.365 kbp) score=10
OG2516_02838 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor OG2516:588..588.7 kbp (774 bp) score=10
OG2516_03213 molybdenum cofactor biosynthesis protein A OG2516:660.5..661.7 kbp (1.17 kbp) score=10
OG2516_03473 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family OG2516:711.4..712.4 kbp (978 bp) score=10
OG2516_03488 COG2890 Methylase of polypeptide chain release factors OG2516:713.4..714.3 kbp (870 bp) score=10
OG2516_03700 iron-sulfur cluster assembly transcription factor IscR, putative OG2516:764.5..765 kbp (432 bp) score=10
OG2516_04581 EF-Tu; elongation factor Tu OG2516:967..968.8 kbp (1.821 kbp) score=10
OG2516_04668 RNA polymerase sigma factor OG2516:983.9..985.9 kbp (1.974 kbp) score=10
OG2516_05293 RNA polymerase sigma-70 factor OG2516:1.113..1.114 Mbp (528 bp) score=10
OG2516_05728 RNA polymerase sigma factor OG2516:1.205..1.206 Mbp (894 bp) score=10
OG2516_05943 RNA polymerase sigma-70 factor OG2516:1.251..1.251 Mbp (702 bp) score=10
OG2516_05948 RNA polymerase sigma factor OG2516:1.251..1.252 Mbp (543 bp) score=10
OG2516_06042 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase OG2516:1.27..1.271 Mbp (1.089 kbp) score=10
OG2516_06846 RNA polymerase sigma factor OG2516:1.426..1.427 Mbp (1.416 kbp) score=10
OG2516_06851 sigma32-like factor OG2516:1.427..1.428 Mbp (726 bp) score=10
OG2516_07061 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain OG2516:1.472..1.473 Mbp (909 bp) score=10
OG2516_07577 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain OG2516:1.59..1.593 Mbp (2.964 kbp) score=10
OG2516_07767 RNA polymerase sigma factor OG2516:1.63..1.631 Mbp (846 bp) score=10
OG2516_08571 transcription termination/antitermination factor NusG OG2516:1.778..1.779 Mbp (534 bp) score=10
OG2516_10311 RNA polymerase sigma-70 factor OG2516:2.097..2.098 Mbp (522 bp) score=10
OG2516_10781 COG1186 Protein chain release factor B OG2516:2.201..2.201 Mbp (420 bp) score=10
OG2516_10791 COG1186 Protein chain release factor B OG2516:2.203..2.203 Mbp (303 bp) score=10
rho transcription termination factor Rho OG2516:2.316..2.316 Mbp (219 bp) score=10
OG2516_12341 molybdenum cofactor biosynthesis domain protein OG2516:2.542..2.542 Mbp (723 bp) score=10
OG2516_13164 COG0782 Transcription elongation factor OG2516:2.722..2.723 Mbp (453 bp) score=10
OG2516_13034 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain OG2516:2.753..2.754 Mbp (951 bp) score=10
OG2516_14521 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase OG2516:3.035..3.038 Mbp (2.256 kbp) score=10
OG2516_14825 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain OG2516:3.109..3.11 Mbp (972 bp) score=10
OG2516_15134 COG3175 Cytochrome oxidase assembly factor OG2516:3.18..3.18 Mbp (606 bp) score=10
OG2516_15124 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) OG2516:3.181..3.182 Mbp (933 bp) score=10
OG2516_15194 RNA polymerase sigma-70 factor OG2516:3.191..3.191 Mbp (486 bp) score=10
OG2516_16501 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain OG2516:3.477..3.478 Mbp (945 bp) score=10
OG2516_16776 molybdenum cofactor biosynthesis protein B OG2516:3.546..3.547 Mbp (540 bp) score=10
OG2516_16906 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) OG2516:3.555..3.556 Mbp (873 bp) score=10
OG2516_16936 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain OG2516:3.56..3.562 Mbp (2.01 kbp) score=10
OG2516_17006 integration host factor beta subunit OG2516:3.577..3.578 Mbp (282 bp) score=10
OG2516_17990 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain OG2516:3.773..3.774 Mbp (987 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70