Roseobase: Oceanicola batsensis HTCC2597

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: OB2597:300000..400000, OB2597_00525, argJ, ZP_01001614, translation initiation factor, KRNPYQGGAMHGFDASEALDIAGVERVIDLGDGVAVVAS.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 80 regions match your request.
Matches on OB2597
overview_OB2597
OB2597_00585 translation initiation factor COG0290 Translation initiation factor 3 (IF-3) OB2597:116.8..117.3 kbp (495 bp) score=60
OB2597_08629 translation initiation factor IF-1 COG0361 Translation initiation factor 1 (IF-1) OB2597:1.768..1.768 Mbp (219 bp) score=60
OB2597_08819 elongation factor P COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) OB2597:1.815..1.816 Mbp (525 bp) score=60
infB translation initiation factor IF-2 COG0532 Translation initiation factor 2 (IF-2; GTPase) OB2597:2.509..2.511 Mbp (2.511 kbp) score=60
OB2597_07979 translation elongation factor Tu COG0050 GTPases - translation elongation factors OB2597:1.643..1.644 Mbp (1.176 kbp) score=40
OB2597_07984 translation elongation factor G COG0480 Translation elongation factors (GTPases) OB2597:1.644..1.646 Mbp (2.124 kbp) score=40
OB2597_08109 translation elongation factor Tu COG0050 GTPases - translation elongation factors OB2597:1.675..1.676 Mbp (1.176 kbp) score=40
OB2597_09864 Putative translation factor COG0009 Putative translation factor (SUA5) OB2597:2.049..2.05 Mbp (945 bp) score=40
OB2597_01722 COG0532 Translation initiation factor 2 (IF-2; GTPase) OB2597:357.6..358.1 kbp (525 bp) score=30
tsf elongation factor Ts COG0264 Translation elongation factor Ts OB2597:673.4..674.2 kbp (843 bp) score=30
OB2597_05160 COG0532 Translation initiation factor 2 (IF-2; GTPase) OB2597:1.078..1.079 Mbp (1.794 kbp) score=30
OB2597_05450 COG0532 Translation initiation factor 2 (IF-2; GTPase) OB2597:1.131..1.132 Mbp (1.107 kbp) score=30
OB2597_12653 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) OB2597:2.594..2.595 Mbp (675 bp) score=30
OB2597_00125 molybdenum cofactor biosynthesis protein A COG2896 Molybdenum cofactor biosynthesis enzyme OB2597:29.45..30.45 kbp (1.008 kbp) score=20
OB2597_00390 peptide chain release factor 3 COG4108 Peptide chain release factor RF-3 OB2597:76.96..78.56 kbp (1.608 kbp) score=20
OB2597_01060 transcription antitermination factor NusB COG0781 Transcription termination factor OB2597:215.6..216.1 kbp (501 bp) score=20
OB2597_01412 molybdenum cofactor biosynthesis protein C COG0315 Molybdenum cofactor biosynthesis enzyme OB2597:266.2..266.6 kbp (477 bp) score=20
OB2597_01762 ribosome recycling factor COG0233 Ribosome recycling factor OB2597:368.1..368.7 kbp (564 bp) score=20
OB2597_03479 peptide chain release factor 1 COG0216 Protein chain release factor A OB2597:703.7..704.7 kbp (1.05 kbp) score=20
OB2597_03604 transcription-repair coupling factor COG1197 Transcription-repair coupling factor (superfamily II helicase) OB2597:725.5..729 kbp (3.459 kbp) score=20
OB2597_03819 trigger factor COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) OB2597:772.4..773.7 kbp (1.329 kbp) score=20
OB2597_05865 COG0251 Putative translation initiation inhibitor, yjgF family OB2597:1.227..1.227 Mbp (408 bp) score=20
OB2597_07390 putative virulence factor, MviN COG0728 Uncharacterized membrane protein, putative virulence factor OB2597:1.548..1.55 Mbp (1.536 kbp) score=20
OB2597_07610 molybdopterin converting factor, subunit 2 COG0314 Molybdopterin converting factor, large subunit OB2597:1.586..1.587 Mbp (438 bp) score=20
OB2597_07615 putative molybdopterin MPT converting factor, subunit 1 protein COG1977 Molybdopterin converting factor, small subunit OB2597:1.587..1.587 Mbp (246 bp) score=20
OB2597_08414 COG0251 Putative translation initiation inhibitor, yjgF family OB2597:1.729..1.729 Mbp (405 bp) score=20
OB2597_09149 COG0012 Predicted GTPase, probable translation factor OB2597:1.895..1.896 Mbp (1.098 kbp) score=20
OB2597_09349 xanthine dehydrogenase accessory factor COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family OB2597:1.943..1.944 Mbp (930 bp) score=20
OB2597_09914 transcription elongation factor GreA COG0782 Transcription elongation factor OB2597:2.057..2.058 Mbp (471 bp) score=20
OB2597_10731 COG0251 Putative translation initiation inhibitor, yjgF family OB2597:2.214..2.214 Mbp (468 bp) score=20
OB2597_11196 ribosome-binding factor A COG0858 Ribosome-binding factor A OB2597:2.305..2.306 Mbp (405 bp) score=20
OB2597_12226 transcription elongation factor NusA COG0195 Transcription elongation factor OB2597:2.512..2.514 Mbp (1.611 kbp) score=20
rho transcription termination factor Rho COG1158 Transcription termination factor OB2597:2.576..2.578 Mbp (1.272 kbp) score=20
dnaA chromosomal replication initiation protein COG0593 ATPase involved in DNA replication initiation OB2597:2.646..2.648 Mbp (1.413 kbp) score=20
OB2597_13673 Anti-sigma factor ChrR COG3806 Anti-sigma factor OB2597:2.831..2.832 Mbp (645 bp) score=20
OB2597_14038 Class I peptide chain release factor COG1186 Protein chain release factor B OB2597:2.91..2.911 Mbp (414 bp) score=20
OB2597_14996 peptide chain release factor 2 COG1186 Protein chain release factor B OB2597:3.11..3.111 Mbp (1.125 kbp) score=20
OB2597_00365 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor OB2597:71.39..72.17 kbp (780 bp) score=10
OB2597_00565 COG3552 Protein containing von Willebrand factor type A (vWA) domain OB2597:111..112.2 kbp (1.257 kbp) score=10
OB2597_00575 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family OB2597:114.6..115.6 kbp (969 bp) score=10
OB2597_00855 RNA polymerase sigma-70 factor OB2597:170.9..171.4 kbp (519 bp) score=10
OB2597_01000 RNA polymerase sigma factor OB2597:203.3..205.3 kbp (1.992 kbp) score=10
OB2597_01517 von Willebrand factor type A domain OB2597:242.5..244.7 kbp (2.253 kbp) score=10
OB2597_01407 molybdenum cofactor biosynthesis protein A OB2597:266.6..267.8 kbp (1.185 kbp) score=10
OB2597_01372 COG1138 Cytochrome c biogenesis factor OB2597:275.5..277.5 kbp (1.962 kbp) score=10
OB2597_01867 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation OB2597:389.4..390.7 kbp (1.368 kbp) score=10
OB2597_02077 RNA polymerase sigma factor OB2597:430.7..431.6 kbp (897 bp) score=10
OB2597_02422 integration host factor, alpha subunit OB2597:496.9..497.2 kbp (303 bp) score=10
OB2597_03137 COG1923 Uncharacterized host factor I protein OB2597:637.3..637.5 kbp (240 bp) score=10
OB2597_03474 COG2890 Methylase of polypeptide chain release factors OB2597:702.9..703.7 kbp (840 bp) score=10
OB2597_03589 iron-sulfur cluster assembly transcription factor IscR, putative OB2597:724..724.5 kbp (498 bp) score=10
tig trigger factor OB2597:771.9..772.3 kbp (351 bp) score=10
OB2597_04725 COG4235 Cytochrome c biogenesis factor OB2597:1.001..1.003 Mbp (1.434 kbp) score=10
OB2597_05035 COG0728 Uncharacterized membrane protein, putative virulence factor OB2597:1.052..1.053 Mbp (897 bp) score=10
OB2597_05285 COG0782 Transcription elongation factor OB2597:1.098..1.098 Mbp (444 bp) score=10
OB2597_07340 RNA polymerase sigma factor OB2597:1.537..1.538 Mbp (879 bp) score=10
OB2597_07840 COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain OB2597:1.628..1.629 Mbp (735 bp) score=10
OB2597_08054 transcription termination/antitermination factor NusG OB2597:1.663..1.663 Mbp (534 bp) score=10
OB2597_08939 COG4447 Uncharacterized protein related to plant photosystem II stability/assembly factor OB2597:1.842..1.844 Mbp (1.161 kbp) score=10
OB2597_09839 molybdenum cofactor biosynthesis protein B OB2597:2.042..2.043 Mbp (528 bp) score=10
OB2597_09954 integration host factor beta subunit OB2597:2.063..2.064 Mbp (285 bp) score=10
OB2597_10441 RNA polymerase sigma-70 factor OB2597:2.157..2.158 Mbp (555 bp) score=10
OB2597_10921 molybdenum cofactor biosynthesis domain protein OB2597:2.247..2.248 Mbp (732 bp) score=10
OB2597_11301 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) OB2597:2.325..2.326 Mbp (897 bp) score=10
OB2597_13678 RNA polymerase sigma-70 factor OB2597:2.832..2.832 Mbp (594 bp) score=10
OB2597_15080 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase OB2597:3.129..3.13 Mbp (1.089 kbp) score=10
OB2597_15345 COG0593 ATPase involved in DNA replication initiation OB2597:3.185..3.185 Mbp (681 bp) score=10
OB2597_15550 RNA polymerase sigma-70 factor OB2597:3.216..3.216 Mbp (540 bp) score=10
OB2597_15595 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase OB2597:3.225..3.227 Mbp (2.196 kbp) score=10
OB2597_15850 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) OB2597:3.278..3.279 Mbp (939 bp) score=10
OB2597_15860 COG3175 Cytochrome oxidase assembly factor OB2597:3.279..3.28 Mbp (576 bp) score=10
OB2597_16275 RNA polymerase sigma factor OB2597:3.421..3.421 Mbp (543 bp) score=10
OB2597_16432 COG4235 Cytochrome c biogenesis factor OB2597:3.5..3.501 Mbp (1.152 kbp) score=10
OB2597_16417 COG1138 Cytochrome c biogenesis factor OB2597:3.503..3.504 Mbp (1.863 kbp) score=10
OB2597_16857 COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) OB2597:3.542..3.543 Mbp (735 bp) score=10
OB2597_17197 RNA polymerase ECF-type sigma factor OB2597:3.593..3.594 Mbp (858 bp) score=10
OB2597_19256 sigma factor, RpoE OB2597:4.043..4.043 Mbp (516 bp) score=10
OB2597_19701 COG0593 ATPase involved in DNA replication initiation OB2597:4.138..4.139 Mbp (726 bp) score=10
OB2597_20251 RNA polymerase sigma factor OB2597:4.246..4.248 Mbp (1.344 kbp) score=10
OB2597_20256 RNA polymerase sigma-70 factor family protein OB2597:4.248..4.249 Mbp (750 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70