Roseobase: Octadecabacter antarcticus str. 238

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: OA238:300000..400000, OA238_2174, OA238_5683, OA238_5561, aatA, ZP_05063743, glucose-6-phosphate dehydrogenase, MLNDEANESADGDVIATLQASALRRIFAYGAVFILGAMLILLAFV.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 7 regions match your request.
Matches on OA238
overview_OA238
OA238_c46010 UTP--glucose-1-phosphate uridylyltransferase 'alternative name(s): UDP-glucose pyrophosphorylase; UDPGP; Alpha-D-glucosyl-1-phosphate uridylyltransferase; Uridine diphosphoglucose pyrophosphorylase' OA238:4.911..4.912 Mbp (888 bp) score=30
OA238_c47910 UTP--glucose-1-phosphate uridylyltransferase 'alternative name(s): UDP-glucose pyrophosphorylase; UDPGP; Alpha-D-glucosyl-1-phosphate uridylyltransferase; Uridine diphosphoglucose pyrophosphorylase' OA238:5.119..5.12 Mbp (894 bp) score=30
pgi glucose-6-phosphate isomerase Pgi OA238:2.321..2.323 Mbp (1.596 kbp) score=10
zwf glucose-6-phosphate1-dehydrogenase Zwf OA238:2.324..2.325 Mbp (1.455 kbp) score=10
glgC glucose-1-phosphate adenylyltransferase GlgC OA238:3.631..3.632 Mbp (1.26 kbp) score=10
ugd UDP-glucose6-dehydrogenase Ugd OA238:4.384..4.385 Mbp (1.338 kbp) score=10
galE UDP-glucose4-epimerase GalE OA238:4.403..4.404 Mbp (1.005 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70