Roseobase: Sulfitobacter sp. NAS-14.1

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: NAS141:300000..400000, NAS141_14106, carB, ZP_00948312, translation initiation factor, LDHIPVIVGGIIPEEDAKRLRAMGVARVYTPKDFELNTIMADIVTLADPETVAAE.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 80 regions match your request.
Matches on NAS141
overview_NAS141
NAS141_08176 elongation factor P COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) NAS141:1.637..1.637 Mbp (564 bp) score=60
infB translation initiation factor IF-2 COG0532 Translation initiation factor 2 (IF-2; GTPase) NAS141:2.488..2.49 Mbp (2.484 kbp) score=60
NAS141_15073 translation initiation factor IF-1 COG0361 Translation initiation factor 1 (IF-1) NAS141:3.018..3.018 Mbp (219 bp) score=60
NAS141_18719 translation initiation factor COG0290 Translation initiation factor 3 (IF-3) NAS141:3.771..3.772 Mbp (606 bp) score=60
NAS141_07970 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB NAS141:1.594..1.594 Mbp (405 bp) score=40
NAS141_09631 translation elongation factor Tu COG0050 GTPases - translation elongation factors NAS141:1.898..1.899 Mbp (1.176 kbp) score=40
NAS141_09636 translation elongation factor G COG0480 Translation elongation factors (GTPases) NAS141:1.899..1.902 Mbp (2.127 kbp) score=40
NAS141_09711 translation elongation factor Tu COG0050 GTPases - translation elongation factors NAS141:1.918..1.919 Mbp (1.176 kbp) score=40
NAS141_14126 Translation elongation factor, selenocysteine-specific COG3276 Selenocysteine-specific translation elongation factor NAS141:2.839..2.841 Mbp (1.872 kbp) score=40
tsf elongation factor Ts COG0264 Translation elongation factor Ts NAS141:1.076..1.077 Mbp (876 bp) score=30
NAS141_10941 anti-anti-sigma factor COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) NAS141:2.174..2.175 Mbp (342 bp) score=30
NAS141_12151 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) NAS141:2.423..2.424 Mbp (693 bp) score=30
NAS141_13646 COG0532 Translation initiation factor 2 (IF-2; GTPase) NAS141:2.74..2.74 Mbp (285 bp) score=30
NAS141_00055 COG0251 Putative translation initiation inhibitor, yjgF family NAS141:18.34..18.65 kbp (312 bp) score=20
NAS141_01046 COG0264 Translation elongation factor Ts NAS141:210.6..211.2 kbp (549 bp) score=20
NAS141_05213 transcription-repair coupling factor COG1197 Transcription-repair coupling factor (superfamily II helicase) NAS141:1.025..1.029 Mbp (3.489 kbp) score=20
NAS141_05263 peptide chain release factor 1 COG0216 Protein chain release factor A NAS141:1.036..1.037 Mbp (1.056 kbp) score=20
NAS141_06308 putative RNA polymerase ECF-subfamily sigma factor COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain NAS141:1.241..1.242 Mbp (1.2 kbp) score=20
NAS141_06423 molybdenum cofactor biosynthesis protein C COG0315 Molybdenum cofactor biosynthesis enzyme NAS141:1.267..1.267 Mbp (474 bp) score=20
NAS141_06668 peptide chain release factor 3 COG4108 Peptide chain release factor RF-3 NAS141:1.318..1.32 Mbp (1.719 kbp) score=20
NAS141_06893 molybdenum cofactor biosynthesis protein A COG2896 Molybdenum cofactor biosynthesis enzyme NAS141:1.363..1.364 Mbp (1.008 kbp) score=20
NAS141_07840 transcription antitermination factor NusB COG0781 Transcription termination factor NAS141:1.57..1.57 Mbp (480 bp) score=20
NAS141_09041 transcription elongation factor GreA COG0782 Transcription elongation factor NAS141:1.8..1.801 Mbp (471 bp) score=20
NAS141_09106 COG0009 Putative translation factor (SUA5) NAS141:1.811..1.812 Mbp (945 bp) score=20
NAS141_09216 molybdopterin converting factor, subunit 2 COG0314 Molybdopterin converting factor, large subunit NAS141:1.832..1.832 Mbp (444 bp) score=20
NAS141_09221 molybdopterin converting factor, subunit 1 COG1977 Molybdopterin converting factor, small subunit NAS141:1.832..1.832 Mbp (246 bp) score=20
dnaA chromosomal replication initiation protein COG0593 ATPase involved in DNA replication initiation NAS141:2.056..2.057 Mbp (1.359 kbp) score=20
NAS141_10761 ribosome-binding factor A COG0858 Ribosome-binding factor A NAS141:2.136..2.136 Mbp (429 bp) score=20
NAS141_10946 anti-sigma B factor, putative COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) NAS141:2.175..2.175 Mbp (480 bp) score=20
rho transcription termination factor Rho COG1158 Transcription termination factor NAS141:2.442..2.443 Mbp (1.272 kbp) score=20
NAS141_12466 transcription elongation factor NusA COG0195 Transcription elongation factor NAS141:2.486..2.487 Mbp (1.641 kbp) score=20
NAS141_13206 COG0251 Putative translation initiation inhibitor, yjgF family NAS141:2.658..2.659 Mbp (459 bp) score=20
NAS141_13701 putative virulence factor, MviN COG0728 Uncharacterized membrane protein, putative virulence factor NAS141:2.747..2.749 Mbp (1.593 kbp) score=20
NAS141_14526 COG0012 Predicted GTPase, probable translation factor NAS141:2.915..2.916 Mbp (1.107 kbp) score=20
NAS141_15988 xanthine dehydrogenase accessory factor COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family NAS141:3.214..3.215 Mbp (972 bp) score=20
NAS141_18234 COG0251 Putative translation initiation inhibitor, yjgF family NAS141:3.68..3.68 Mbp (381 bp) score=20
tig trigger factor COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) NAS141:3.697..3.698 Mbp (1.332 kbp) score=20
NAS141_19444 COG0480 Translation elongation factors (GTPases) NAS141:3.908..3.908 Mbp (807 bp) score=20
NAS141_19589 peptide chain release factor 2 COG1186 Protein chain release factor B NAS141:3.94..3.942 Mbp (1.125 kbp) score=20
NAS141_19884 ribosome recycling factor COG0233 Ribosome recycling factor NAS141:4.007..4.007 Mbp (564 bp) score=20
NAS141_00590 hemin degrading factor NAS141:109..110.1 kbp (1.056 kbp) score=10
NAS141_00970 COG0593 ATPase involved in DNA replication initiation NAS141:190..190.7 kbp (696 bp) score=10
NAS141_01416 COG0195 Transcription elongation factor NAS141:271.9..272.4 kbp (492 bp) score=10
NAS141_02126 COG1138 Cytochrome c biogenesis factor NAS141:408.7..410.7 kbp (2.001 kbp) score=10
NAS141_02141 COG4235 Cytochrome c biogenesis factor NAS141:411.7..412.9 kbp (1.158 kbp) score=10
NAS141_02711 RepC, replication initiation protein RepC NAS141:502.7..503.7 kbp (1.035 kbp) score=10
NAS141_03526 RNA polymerase sigma-32 factor NAS141:679.3..679.9 kbp (672 bp) score=10
NAS141_03656 putative RNA polymerase sigma-e factor (sigma-24) protein NAS141:712.9..713.4 kbp (504 bp) score=10
NAS141_04983 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation NAS141:980.7..982 kbp (1.353 kbp) score=10
NAS141_05168 COG1923 Uncharacterized host factor I protein NAS141:1.016..1.017 Mbp (240 bp) score=10
NAS141_05268 COG2890 Methylase of polypeptide chain release factors NAS141:1.037..1.038 Mbp (843 bp) score=10
NAS141_06103 integration host factor, alpha subunit NAS141:1.202..1.202 Mbp (303 bp) score=10
NAS141_06428 molybdenum cofactor biosynthesis protein A NAS141:1.267..1.269 Mbp (1.173 kbp) score=10
NAS141_06473 COG1138 Cytochrome c biogenesis factor NAS141:1.276..1.278 Mbp (2.004 kbp) score=10
NAS141_06523 COG3552 Protein containing von Willebrand factor type A (vWA) domain NAS141:1.29..1.291 Mbp (1.263 kbp) score=10
NAS141_06688 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor NAS141:1.324..1.325 Mbp (774 bp) score=10
NAS141_07183 COG3806 Anti-sigma factor NAS141:1.428..1.428 Mbp (681 bp) score=10
NAS141_07805 RNA polymerase sigma factor NAS141:1.564..1.565 Mbp (840 bp) score=10
NAS141_07910 RNA polymerase sigma factor NAS141:1.582..1.584 Mbp (1.983 kbp) score=10
NAS141_07950 RNA polymerase sigma-70 factor NAS141:1.592..1.592 Mbp (510 bp) score=10
NAS141_07960 RNA polymerase sigma-70 factor, ECF family protein NAS141:1.593..1.593 Mbp (687 bp) score=10
NAS141_08341 integration host factor beta subunit NAS141:1.667..1.668 Mbp (285 bp) score=10
NAS141_09131 molybdenum cofactor biosynthesis protein B NAS141:1.819..1.819 Mbp (543 bp) score=10
NAS141_09701 transcription termination/antitermination factor NusG NAS141:1.916..1.917 Mbp (534 bp) score=10
NAS141_11401 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) NAS141:2.265..2.266 Mbp (885 bp) score=10
NAS141_11461 COG1186 Protein chain release factor B NAS141:2.281..2.281 Mbp (465 bp) score=10
NAS141_11871 RNA polymerase sigma-70 factor NAS141:2.364..2.365 Mbp (558 bp) score=10
NAS141_12201 COG0195 Transcription elongation factor NAS141:2.437..2.437 Mbp (660 bp) score=10
NAS141_13071 COG1197 Transcription-repair coupling factor (superfamily II helicase) NAS141:2.631..2.631 Mbp (357 bp) score=10
NAS141_13261 molybdenum cofactor biosynthesis domain protein NAS141:2.667..2.667 Mbp (768 bp) score=10
NAS141_13446 nuclear receptor binding factor related protein NAS141:2.703..2.704 Mbp (981 bp) score=10
NAS141_13746 RNA polymerase sigma factor NAS141:2.758..2.759 Mbp (888 bp) score=10
NAS141_14643 RNA polymerase sigma-70 factor NAS141:2.934..2.935 Mbp (543 bp) score=10
NAS141_14693 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase NAS141:2.943..2.945 Mbp (2.199 kbp) score=10
NAS141_14923 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) NAS141:2.99..2.991 Mbp (936 bp) score=10
NAS141_14933 COG3175 Cytochrome oxidase assembly factor NAS141:2.991..2.992 Mbp (576 bp) score=10
NAS141_17079 COG0593 ATPase involved in DNA replication initiation NAS141:3.453..3.454 Mbp (684 bp) score=10
NAS141_17779 COG4235 Cytochrome c biogenesis factor NAS141:3.587..3.588 Mbp (1.227 kbp) score=10
NAS141_18689 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family NAS141:3.763..3.764 Mbp (969 bp) score=10
NAS141_19424 iron-sulfur cluster assembly transcription factor IscR, putative NAS141:3.904..3.905 Mbp (471 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70