- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: MED193:2300000..2400000, MED193_19604, alr, ZP_01058064, transcriptional regulator, ATAATMSRVALPELKAYGYAGGFSTATLAAGGTLGILIPPSVVLVIYAILTEQNIAKLFLAAFIPGILAAAGYMITIAIY.

[Bookmark this] [Upload your own data] [Show banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 348 regions match your request.
Matches on MED193
overview_MED193
MED193_00130 COG0583 Transcriptional regulator transcriptional regulator CatR MED193:24.77..25.67 kbp (900 bp) score=40
MED193_00225 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:43.16..44.14 kbp (972 bp) score=40
MED193_00295 COG2944 Predicted transcriptional regulator transcriptional regulator, XRE family protein MED193:58.92..59.21 kbp (294 bp) score=40
MED193_00710 COG1846 Transcriptional regulators transcriptional regulatory protein MED193:154.2..154.6 kbp (444 bp) score=40
MED193_00820 COG0640 Predicted transcriptional regulators transcriptional regulator/arsenate reductase MED193:177.3..178.1 kbp (834 bp) score=40
MED193_00855 COG1396 Predicted transcriptional regulators probable transcriptional regulator MED193:184.2..184.9 kbp (702 bp) score=40
MED193_01135 COG0583 Transcriptional regulator Transcriptional regulator MED193:244.8..245.6 kbp (876 bp) score=40
MED193_01225 COG1846 Transcriptional regulators transcriptional regulatory protein MED193:266..266.4 kbp (441 bp) score=40
MED193_01275 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:275.2..275.8 kbp (678 bp) score=40
MED193_01535 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:333..333.9 kbp (897 bp) score=40
MED193_01540 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:333.9..334.8 kbp (888 bp) score=40
MED193_01700 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:370.2..370.6 kbp (450 bp) score=40
MED193_01795 COG0583 Transcriptional regulator probable transcriptional regulator MED193:390.9..391.8 kbp (879 bp) score=40
MED193_01810 COG0640 Predicted transcriptional regulators transcriptional regulatory protein MED193:392.9..393.2 kbp (345 bp) score=40
MED193_01850 COG1609 Transcriptional regulators probable LacI-family transcriptional regulator MED193:400.7..401.7 kbp (1.089 kbp) score=40
MED193_01905 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:410.5..411 kbp (519 bp) score=40
MED193_01945 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:421.3..422 kbp (687 bp) score=40
MED193_02240 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein MED193:477..477.4 kbp (441 bp) score=40
MED193_02425 COG0789 Predicted transcriptional regulators Cu(I)-responsive transcriptional regulator MED193:507.7..508.1 kbp (399 bp) score=40
MED193_02535 COG1309 Transcriptional regulator possible transcriptional regulator, TetR family protein MED193:528.8..529.3 kbp (498 bp) score=40
MED193_02795 COG2186 Transcriptional regulators transcriptional regulator, GntR family protein MED193:575..575.7 kbp (732 bp) score=40
MED193_02860 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:589.4..590.3 kbp (885 bp) score=40
MED193_03010 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:627.9..628.4 kbp (516 bp) score=40
MED193_03537 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:733.6..734.5 kbp (969 bp) score=40
MED193_03617 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:747.3..748.2 kbp (924 bp) score=40
MED193_04032 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:838.1..839.1 kbp (915 bp) score=40
MED193_04097 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein MED193:852..852.9 kbp (912 bp) score=40
MED193_04181 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:869.3..869.8 kbp (483 bp) score=40
MED193_04196 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:871.5..871.9 kbp (426 bp) score=40
MED193_04681 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:977.2..978.2 kbp (960 bp) score=40
MED193_04731 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:988.2..988.8 kbp (615 bp) score=40
MED193_04751 COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs transcriptional regulator, GntR family protein MED193:990.9..992.3 kbp (1.404 kbp) score=40
MED193_04791 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:999.3 kbp..1 Mbp (969 bp) score=40
MED193_05524 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:1.143..1.144 Mbp (615 bp) score=40
MED193_05599 COG1396 Predicted transcriptional regulators transcriptional regulator, putative MED193:1.157..1.158 Mbp (1.299 kbp) score=40
MED193_05709 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein MED193:1.176..1.177 Mbp (1.008 kbp) score=40
MED193_05774 COG0640 Predicted transcriptional regulators transcriptional regulator SoxR MED193:1.189..1.189 Mbp (342 bp) score=40
MED193_05929 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein MED193:1.222..1.222 Mbp (339 bp) score=40
MED193_05934 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein MED193:1.223..1.223 Mbp (414 bp) score=40
MED193_06139 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:1.264..1.264 Mbp (492 bp) score=40
MED193_06394 COG0583 Transcriptional regulator probable transcriptional regulator MED193:1.304..1.305 Mbp (1.032 kbp) score=40
MED193_06464 COG1802 Transcriptional regulators GntR family transcriptional regulator MED193:1.326..1.326 Mbp (720 bp) score=40
MED193_06529 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:1.339..1.339 Mbp (456 bp) score=40
MED193_06624 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:1.359..1.359 Mbp (468 bp) score=40
MED193_07109 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:1.451..1.452 Mbp (456 bp) score=40
MED193_07264 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:1.485..1.486 Mbp (636 bp) score=40
MED193_07593 COG1309 Transcriptional regulator Transcriptional regulator MED193:1.562..1.563 Mbp (615 bp) score=40
MED193_07878 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:1.626..1.627 Mbp (645 bp) score=40
MED193_07908 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:1.632..1.633 Mbp (909 bp) score=40
MED193_07913 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:1.633..1.634 Mbp (924 bp) score=40
MED193_08038 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:1.659..1.659 Mbp (510 bp) score=40
MED193_08158 COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain putative transcriptional regulator protein MED193:1.683..1.684 Mbp (1.104 kbp) score=40
MED193_08218 COG0583 Transcriptional regulator Transcriptional regulator MED193:1.695..1.696 Mbp (927 bp) score=40
MED193_08318 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:1.714..1.715 Mbp (456 bp) score=40
MED193_08343 COG1329 Transcriptional regulators, similar to M. xanthus CarD transcriptional regulator, CarD family protein MED193:1.72..1.721 Mbp (513 bp) score=40
MED193_08618 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:1.772..1.773 Mbp (588 bp) score=40
MED193_08758 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:1.803..1.804 Mbp (660 bp) score=40
MED193_08783 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:1.808..1.808 Mbp (477 bp) score=40
MED193_08788 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:1.808..1.809 Mbp (498 bp) score=40
MED193_09385 COG1414 Transcriptional regulator putative transcriptional regulator, IclR family protein MED193:1.925..1.926 Mbp (777 bp) score=40
MED193_09425 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:1.933..1.934 Mbp (945 bp) score=40
MED193_09530 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:1.972..1.972 Mbp (735 bp) score=40
MED193_09600 COG3682 Predicted transcriptional regulator transcriptional regulator, putative MED193:1.986..1.986 Mbp (417 bp) score=40
MED193_09635 COG1802 Transcriptional regulators probable transcriptional regulator MED193:1.992..1.993 Mbp (663 bp) score=40
MED193_09660 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:1.998..1.999 Mbp (564 bp) score=40
MED193_09705 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:2.007..2.008 Mbp (894 bp) score=40
MED193_09875 COG0583 Transcriptional regulator transcriptional regulator, LysR-family protein MED193:2.043..2.044 Mbp (861 bp) score=40
MED193_10066 COG1609 Transcriptional regulators transcriptional regulator, LacI family protein MED193:2.084..2.085 Mbp (1.005 kbp) score=40
MED193_10241 COG1414 Transcriptional regulator transcriptional regulator, IclR family protein MED193:2.125..2.126 Mbp (807 bp) score=40
MED193_10278 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:2.131..2.132 Mbp (651 bp) score=40
MED193_10683 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:2.208..2.209 Mbp (948 bp) score=40
MED193_10918 COG1510 Predicted transcriptional regulators transcriptional regulators-like MED193:2.247..2.248 Mbp (534 bp) score=40
MED193_11043 COG1733 Predicted transcriptional regulators transcriptional regulator, putative MED193:2.269..2.269 Mbp (537 bp) score=40
MED193_11068 COG1309 Transcriptional regulator possible transcriptional regulator, TetR family protein MED193:2.272..2.273 Mbp (639 bp) score=40
MED193_11198 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:2.294..2.295 Mbp (894 bp) score=40
MED193_11313 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:2.318..2.319 Mbp (879 bp) score=40
MED193_11359 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:2.336..2.336 Mbp (549 bp) score=40
MED193_11439 COG1349 Transcriptional regulators of sugar metabolism transcriptional regulator, DeoR family protein MED193:2.353..2.354 Mbp (807 bp) score=40
MED193_11454 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:2.357..2.357 Mbp (435 bp) score=40
MED193_11554 COG0640 Predicted transcriptional regulators transcriptional regulator, ArsR family protein MED193:2.376..2.377 Mbp (702 bp) score=40
MED193_11564 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:2.378..2.378 Mbp (627 bp) score=40
MED193_11594 COG1309 Transcriptional regulator possible transcriptional regulator, TetR family protein MED193:2.383..2.384 Mbp (594 bp) score=40
MED193_11722 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:2.42..2.42 Mbp (642 bp) score=40
MED193_11727 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:2.42..2.421 Mbp (888 bp) score=40
MED193_11747 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:2.426..2.427 Mbp (900 bp) score=40
MED193_11922 COG1846 Transcriptional regulators transcriptional regulator, putative MED193:2.459..2.46 Mbp (519 bp) score=40
MED193_11937 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:2.461..2.461 Mbp (459 bp) score=40
MED193_12052 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:2.48..2.48 Mbp (573 bp) score=40
MED193_12077 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:2.483..2.484 Mbp (453 bp) score=40
MED193_12198 COG0640 Predicted transcriptional regulators transcriptional regulator, ArsR family protein MED193:2.51..2.511 Mbp (312 bp) score=40
MED193_12203 COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs Transcriptional regulator MED193:2.511..2.512 Mbp (1.461 kbp) score=40
MED193_12293 COG1846 Transcriptional regulators transcriptional regulator PecS MED193:2.533..2.533 Mbp (495 bp) score=40
MED193_13088 COG0640 Predicted transcriptional regulators arsR-family transcriptional regulator MED193:2.693..2.693 Mbp (369 bp) score=40
MED193_13198 COG1414 Transcriptional regulator transcriptional regulator, IclR family protein MED193:2.718..2.719 Mbp (795 bp) score=40
MED193_13378 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:2.755..2.756 Mbp (600 bp) score=40
MED193_13468 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:2.775..2.776 Mbp (690 bp) score=40
MED193_14047 COG1846 Transcriptional regulators transcriptional regulator, putative MED193:2.888..2.889 Mbp (441 bp) score=40
MED193_14302 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:2.949..2.95 Mbp (909 bp) score=40
MED193_14312 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein MED193:2.951..2.952 Mbp (969 bp) score=40
MED193_14377 COG1846 Transcriptional regulators transcriptional regulator PetP MED193:2.962..2.963 Mbp (495 bp) score=40
MED193_14392 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:2.965..2.965 Mbp (438 bp) score=40
MED193_14492 COG1309 Transcriptional regulator putative tetR-family transcriptional regulator MED193:2.984..2.984 Mbp (672 bp) score=40
MED193_14792 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein MED193:3.046..3.047 Mbp (954 bp) score=40
MED193_14932 COG1609 Transcriptional regulators transcriptional regulator, LacI family protein MED193:3.081..3.082 Mbp (1.026 kbp) score=40
MED193_14987 COG1802 Transcriptional regulators putative transcriptional regulator (GntR family protein) MED193:3.093..3.094 Mbp (702 bp) score=40
MED193_15022 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein MED193:3.102..3.102 Mbp (429 bp) score=40
MED193_15477 COG0583 Transcriptional regulator transcriptional regulatory protein MED193:3.2..3.201 Mbp (912 bp) score=40
MED193_15637 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.238..3.239 Mbp (900 bp) score=40
MED193_16052 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.321..3.322 Mbp (918 bp) score=40
MED193_16182 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.341..3.342 Mbp (879 bp) score=40
MED193_16192 COG0640 Predicted transcriptional regulators transcriptional regulator, ArsR family protein MED193:3.343..3.343 Mbp (354 bp) score=40
MED193_17004 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.488..3.489 Mbp (888 bp) score=40
MED193_17089 COG1609 Transcriptional regulators transcriptional regulator, LacI family protein MED193:3.501..3.502 Mbp (1.008 kbp) score=40
MED193_17184 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:3.519..3.52 Mbp (732 bp) score=40
MED193_17324 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:3.551..3.551 Mbp (597 bp) score=40
MED193_17404 COG1846 Transcriptional regulators putative MarR-family transcriptional regulator MED193:3.568..3.569 Mbp (552 bp) score=40
MED193_17599 COG2188 Transcriptional regulators transcriptional regulator, GntR family protein MED193:3.607..3.608 Mbp (750 bp) score=40
MED193_17734 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:3.635..3.635 Mbp (675 bp) score=40
MED193_17744 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:3.639..3.639 Mbp (462 bp) score=40
MED193_17759 COG0640 Predicted transcriptional regulators transcriptional regulator, ArsR family protein MED193:3.643..3.643 Mbp (381 bp) score=40
MED193_17854 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.66..3.661 Mbp (921 bp) score=40
MED193_18164 COG0789 Predicted transcriptional regulators Cu(I)-responsive transcriptional regulator MED193:3.725..3.726 Mbp (390 bp) score=40
MED193_18199 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:3.73..3.731 Mbp (615 bp) score=40
MED193_18329 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:3.761..3.762 Mbp (483 bp) score=40
MED193_18349 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:3.764..3.765 Mbp (666 bp) score=40
MED193_18374 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.771..3.772 Mbp (927 bp) score=40
MED193_18489 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.792..3.793 Mbp (954 bp) score=40
MED193_18504 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.797..3.798 Mbp (978 bp) score=40
MED193_18559 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.808..3.809 Mbp (897 bp) score=40
MED193_18569 COG1802 Transcriptional regulators transcriptional regulator, GntR family protein MED193:3.811..3.812 Mbp (696 bp) score=40
MED193_19069 COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs transcriptional regulator, GntR family protein MED193:3.901..3.903 Mbp (1.401 kbp) score=40
MED193_19289 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein MED193:3.96..3.961 Mbp (1.014 kbp) score=40
MED193_19294 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:3.961..3.962 Mbp (909 bp) score=40
MED193_19329 COG0583 Transcriptional regulator probable transcriptional regulator MED193:3.97..3.971 Mbp (900 bp) score=40
MED193_19339 COG1414 Transcriptional regulator Transcriptional regulator MED193:3.972..3.973 Mbp (762 bp) score=40
MED193_19379 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein MED193:3.981..3.982 Mbp (948 bp) score=40
MED193_19394 COG1522 Transcriptional regulators putative AsnC-family transcriptional regulator MED193:3.984..3.985 Mbp (474 bp) score=40
MED193_19719 COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain transcriptional regulator, AraC family protein MED193:4.052..4.053 Mbp (1.038 kbp) score=40
MED193_19884 COG1846 Transcriptional regulators transcriptional regulatory protein MED193:4.08..4.08 Mbp (423 bp) score=40
MED193_19989 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:4.104..4.105 Mbp (633 bp) score=40
MED193_20024 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:4.109..4.11 Mbp (462 bp) score=40
MED193_20369 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:4.175..4.176 Mbp (483 bp) score=40
MED193_20529 COG0583 Transcriptional regulator probable transcriptional regulator MED193:4.211..4.212 Mbp (876 bp) score=40
MED193_20624 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:4.229..4.23 Mbp (972 bp) score=40
MED193_20754 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:4.256..4.257 Mbp (894 bp) score=40
MED193_20974 COG1846 Transcriptional regulators transcriptional regulator, MarR family protein MED193:4.304..4.304 Mbp (432 bp) score=40
MED193_20999 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:4.308..4.309 Mbp (567 bp) score=40
MED193_21084 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein MED193:4.326..4.326 Mbp (411 bp) score=40
MED193_21234 COG1522 Transcriptional regulators probable transcriptional regulator, AsnC family protein MED193:4.359..4.359 Mbp (477 bp) score=40
MED193_21244 COG1609 Transcriptional regulators Transcriptional regulator MED193:4.36..4.361 Mbp (1.029 kbp) score=40
MED193_21581 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:4.423..4.424 Mbp (882 bp) score=40
MED193_21666 COG1309 Transcriptional regulator transcriptional regulator, TetR family protein MED193:4.444..4.444 Mbp (576 bp) score=40
MED193_21911 COG0583 Transcriptional regulator transcriptional regulatory protein, LysR family protein MED193:4.496..4.497 Mbp (918 bp) score=40
MED193_21966 COG0583 Transcriptional regulator transcriptional regulatory protein MED193:4.509..4.51 Mbp (753 bp) score=40
MED193_22206 COG1522 Transcriptional regulators transcriptional regulator, AsnC family protein MED193:4.557..4.557 Mbp (435 bp) score=40
MED193_22236 COG0583 Transcriptional regulator transcriptional regulator MetR MED193:4.564..4.564 Mbp (906 bp) score=40
MED193_22286 COG1309 Transcriptional regulator transcriptional regulatory protein MED193:4.574..4.574 Mbp (579 bp) score=40
MED193_22456 COG0789 Predicted transcriptional regulators transcriptional regulator, MerR family protein MED193:4.606..4.607 Mbp (1.266 kbp) score=40
MED193_22726 COG0583 Transcriptional regulator transcriptional regulator, LysR family protein MED193:4.663..4.664 Mbp (936 bp) score=40
MED193_00055 COG0583 Transcriptional regulator pca operon transcriptional activator PcaQ MED193:11.17..12.1 kbp (930 bp) score=30
MED193_01340 COG1414 Transcriptional regulator regulatory protein, IclR MED193:285.1..285.9 kbp (795 bp) score=30
MED193_01445 COG1802 Transcriptional regulators regulatory protein GntR, HTH:GntR, C-terminal MED193:311.7..312.4 kbp (657 bp) score=30
MED193_01735 COG0583 Transcriptional regulator regulatory protein, LysR:LysR, substrate-binding MED193:379.2..380.1 kbp (903 bp) score=30
MED193_02725 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains C4-dicarboxylate transport transcriptional regulatory protein DctD MED193:559.9..561.2 kbp (1.338 kbp) score=30
MED193_04037 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain phosphate regulon transcriptional regulatory protein PhoB MED193:839.1..839.8 kbp (690 bp) score=30
MED193_06609 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains C4-dicarboxylate transport transcriptional regulatory protein MED193:1.354..1.355 Mbp (1.233 kbp) score=30
MED193_06949 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor transcriptional activator, Baf family protein MED193:1.421..1.422 Mbp (783 bp) score=30
MED193_10733 COG0789 Predicted transcriptional regulators redox-sensitive transcriptional activator SoxR MED193:2.217..2.218 Mbp (480 bp) score=30
MED193_12323 COG3947 Response regulator containing CheY-like receiver and SARP domains Transcriptional regulator MED193:2.54..2.541 Mbp (1.497 kbp) score=30
MED193_15552 COG1846 Transcriptional regulators regulatory protein, MarR MED193:3.215..3.216 Mbp (483 bp) score=30
MED193_15577 COG1522 Transcriptional regulators proline dehydrogenase transcriptional activator MED193:3.22..3.221 Mbp (453 bp) score=30
MED193_17279 COG0583 Transcriptional regulator putative transcription regulator protein MED193:3.541..3.542 Mbp (909 bp) score=30
MED193_18194 COG0583 Transcriptional regulator putative transcriptional activator of the pca operon, LysR family protein MED193:3.729..3.73 Mbp (924 bp) score=30
MED193_19104 COG1802 Transcriptional regulators putative transcriptional repressor (GntR familiy protein) MED193:3.912..3.912 Mbp (666 bp) score=30
MED193_19534 COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs putative transcription regulator protein MED193:4.015..4.016 Mbp (1.362 kbp) score=30
MED193_19964 COG3629 DNA-binding transcriptional activator of the SARP family Transcriptional regulatory protein-like MED193:4.098..4.1 Mbp (2.019 kbp) score=30
MED193_20299 COG1522 Transcriptional regulators leucine-responsive regulatory protein, putative MED193:4.164..4.164 Mbp (501 bp) score=30
MED193_20864 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases transcriptional regulator, Crp/Fnr family protein MED193:4.279..4.279 Mbp (669 bp) score=30
MED193_22266 COG1522 Transcriptional regulators proline dehydrogenase transcriptional activator MED193:4.571..4.572 Mbp (510 bp) score=30
MED193_00180 COG1846 Transcriptional regulators MED193:35.73..36.22 kbp (489 bp) score=20
MED193_00240 COG1475 Predicted transcriptional regulators MED193:45.57..47.73 kbp (2.16 kbp) score=20
MED193_00350 COG1386 Predicted transcriptional regulator containing the HTH domain MED193:70.63..71.22 kbp (597 bp) score=20
MED193_00410 COG2378 Predicted transcriptional regulator MED193:89.15..90.08 kbp (933 bp) score=20
MED193_00475 COG1802 Transcriptional regulators MED193:102..102.8 kbp (891 bp) score=20
MED193_00520 transcriptional regulator, AraC family protein MED193:112.2..113.1 kbp (975 bp) score=20
MED193_00730 transcriptional regulatory protein MED193:160.3..161.3 kbp (957 bp) score=20
MED193_00740 putative transcriptional regulator MED193:161.8..162.8 kbp (1.023 kbp) score=20
MED193_00780 COG1846 Transcriptional regulators MED193:168.6..169.4 kbp (867 bp) score=20
MED193_00920 COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain MED193:195.3..195.6 kbp (276 bp) score=20
MED193_01120 COG1396 Predicted transcriptional regulators MED193:241..241.7 kbp (666 bp) score=20
MED193_01390 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain two-component response regulator MED193:297.1..297.8 kbp (675 bp) score=20
MED193_01410 COG1475 Predicted transcriptional regulators MED193:301.2..302.3 kbp (1.068 kbp) score=20
MED193_01490 COG1737 Transcriptional regulators MED193:322.3..323.2 kbp (957 bp) score=20
MED193_01690 COG2188 Transcriptional regulators MED193:366.8..367.5 kbp (723 bp) score=20
MED193_01755 COG0583 Transcriptional regulator MED193:383.3..384.2 kbp (873 bp) score=20
MED193_01835 COG0583 Transcriptional regulator MED193:397.1..398 kbp (924 bp) score=20
MED193_02025 COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain MED193:438.3..438.6 kbp (276 bp) score=20
MED193_02105 COG1475 Predicted transcriptional regulators MED193:451.2..453.2 kbp (1.983 kbp) score=20
MED193_02145 COG1475 Predicted transcriptional regulators MED193:459.9..460.9 kbp (984 bp) score=20
MED193_02335 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator MED193:489.6..490.3 kbp (723 bp) score=20
MED193_02555 COG1733 Predicted transcriptional regulators MED193:532.6..533 kbp (480 bp) score=20
MED193_02595 COG1396 Predicted transcriptional regulators MED193:539.6..539.9 kbp (258 bp) score=20
MED193_03152 COG3655 Predicted transcriptional regulator MED193:657.8..658.1 kbp (216 bp) score=20
MED193_03457 COG1396 Predicted transcriptional regulators MED193:714.6..715.4 kbp (762 bp) score=20
MED193_03512 COG1349 Transcriptional regulators of sugar metabolism MED193:726.4..727.1 kbp (720 bp) score=20
MED193_03932 autoinducer-binding transcriptional regulator, LuxR family protein MED193:818.1..818.9 kbp (756 bp) score=20
MED193_04042 COG0704 Phosphate uptake regulator phosphate transport system regulatory protein PhoU MED193:839.8..840.5 kbp (711 bp) score=20
MED193_04321 COG1959 Predicted transcriptional regulator MED193:895.2..895.7 kbp (462 bp) score=20
MED193_04506 COG1396 Predicted transcriptional regulators MED193:939.1..939.7 kbp (624 bp) score=20
MED193_04601 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains nitrogen assimilation regulatory protein NtrX MED193:961.4..962.8 kbp (1.41 kbp) score=20
MED193_04871 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator CtrA MED193:1.016..1.017 Mbp (720 bp) score=20
MED193_04961 transcriptional regulator, AraC family protein MED193:1.035..1.035 Mbp (813 bp) score=20
MED193_05036 COG0347 Nitrogen regulatory protein PII nitrogen regulatory protein P-II MED193:1.053..1.053 Mbp (339 bp) score=20
MED193_05371 transcriptional regulator, AraC family protein MED193:1.116..1.117 Mbp (804 bp) score=20
MED193_05594 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain response regulator MED193:1.157..1.157 Mbp (414 bp) score=20
MED193_05639 transcriptional regulator, LuxR family protein MED193:1.165..1.166 Mbp (528 bp) score=20
MED193_05649 transcriptional regulator, LuxR family protein MED193:1.167..1.168 Mbp (591 bp) score=20
MED193_06149 COG1396 Predicted transcriptional regulators MED193:1.264..1.265 Mbp (402 bp) score=20
MED193_06284 COG3311 Predicted transcriptional regulator MED193:1.286..1.286 Mbp (255 bp) score=20
MED193_06354 COG3311 Predicted transcriptional regulator MED193:1.295..1.295 Mbp (195 bp) score=20
MED193_06884 COG2378 Predicted transcriptional regulator MED193:1.407..1.407 Mbp (681 bp) score=20
MED193_07179 COG1846 Transcriptional regulators MED193:1.466..1.467 Mbp (471 bp) score=20
MED193_07578 COG1522 Transcriptional regulators MED193:1.56..1.56 Mbp (240 bp) score=20
MED193_07603 transcriptional regulator, AraC family protein MED193:1.563..1.564 Mbp (726 bp) score=20
ftrB COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases transcriptional activator FtrB MED193:1.606..1.606 Mbp (693 bp) score=20
MED193_07813 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain Two component response regulator MED193:1.608..1.609 Mbp (747 bp) score=20
MED193_08183 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains two-component system response regulator-like (Ntr family protein) MED193:1.688..1.689 Mbp (354 bp) score=20
MED193_08498 COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains MED193:1.749..1.75 Mbp (468 bp) score=20
MED193_08668 COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain diguanylate cyclase, putative/response regulator MED193:1.784..1.785 Mbp (1.455 kbp) score=20
MED193_08713 transcriptional regulator, LuxR family/hydrolase, alpha/beta fold family protein MED193:1.793..1.795 Mbp (1.758 kbp) score=20
MED193_09800 COG1959 Predicted transcriptional regulator MED193:2.025..2.026 Mbp (474 bp) score=20
MED193_10021 COG1737 Transcriptional regulators MED193:2.074..2.075 Mbp (873 bp) score=20
MED193_10081 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains Sigma-54 dependent response regulator MED193:2.088..2.09 Mbp (1.365 kbp) score=20
MED193_10428 autoinducer-binding transcriptional regulator LuxR MED193:2.16..2.161 Mbp (768 bp) score=20
MED193_10828 COG1678 Putative transcriptional regulator MED193:2.231..2.232 Mbp (600 bp) score=20
MED193_11063 transcriptional regulatory protein MED193:2.272..2.272 Mbp (858 bp) score=20
MED193_11238 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases transcriptional activator protein FnrL MED193:2.301..2.302 Mbp (741 bp) score=20
MED193_11807 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator MED193:2.438..2.438 Mbp (666 bp) score=20
MED193_12067 transcriptional regulator, AraC family protein MED193:2.482..2.483 Mbp (834 bp) score=20
MED193_12383 COG2378 Predicted transcriptional regulator MED193:2.553..2.554 Mbp (987 bp) score=20
MED193_12448 COG1475 Predicted transcriptional regulators MED193:2.562..2.564 Mbp (1.263 kbp) score=20
MED193_12688 COG2378 Predicted transcriptional regulator MED193:2.605..2.606 Mbp (855 bp) score=20
MED193_12798 COG1396 Predicted transcriptional regulators MED193:2.633..2.634 Mbp (549 bp) score=20
MED193_12873 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator MED193:2.651..2.652 Mbp (705 bp) score=20
MED193_13103 COG1733 Predicted transcriptional regulators MED193:2.697..2.697 Mbp (390 bp) score=20
MED193_13288 COG1396 Predicted transcriptional regulators MED193:2.737..2.738 Mbp (567 bp) score=20
MED193_13672 COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain photosynthetic apparatus regulatory protein RegA MED193:2.813..2.813 Mbp (555 bp) score=20
MED193_13837 COG1475 Predicted transcriptional regulators MED193:2.845..2.846 Mbp (906 bp) score=20
MED193_13862 COG1420 Transcriptional regulator of heat shock gene MED193:2.849..2.85 Mbp (1.068 kbp) score=20
MED193_14372 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator PetR MED193:2.962..2.962 Mbp (702 bp) score=20
MED193_14652 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator MED193:3.018..3.019 Mbp (687 bp) score=20
MED193_14757 COG1396 Predicted transcriptional regulators MED193:3.039..3.04 Mbp (477 bp) score=20
MED193_14852 COG3707 Response regulator with putative antiterminator output domain two-component response regulator MED193:3.063..3.064 Mbp (585 bp) score=20
MED193_14867 COG1396 Predicted transcriptional regulators MED193:3.067..3.067 Mbp (423 bp) score=20
MED193_14997 COG1396 Predicted transcriptional regulators MED193:3.094..3.095 Mbp (615 bp) score=20
MED193_15247 transcriptional regulator, LuxR family/hydrolase, alpha/beta fold family protein MED193:3.158..3.16 Mbp (1.734 kbp) score=20
MED193_15727 COG1309 Transcriptional regulator MED193:3.253..3.254 Mbp (606 bp) score=20
MED193_15797 COG1396 Predicted transcriptional regulators MED193:3.267..3.267 Mbp (564 bp) score=20
MED193_15832 COG0347 Nitrogen regulatory protein PII nitrogen regulatory protein P-II MED193:3.273..3.273 Mbp (339 bp) score=20
MED193_16242 COG2186 Transcriptional regulators MED193:3.351..3.352 Mbp (855 bp) score=20
MED193_16247 COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs MED193:3.352..3.353 Mbp (1.218 kbp) score=20
MED193_16484 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA-binding response regulator ChvI MED193:3.395..3.395 Mbp (705 bp) score=20
MED193_17159 COG1475 Predicted transcriptional regulators MED193:3.513..3.513 Mbp (759 bp) score=20
MED193_17344 transcriptional regulator, AraC family protein MED193:3.556..3.557 Mbp (1.017 kbp) score=20
MED193_17399 transcriptional regulator, AraC family protein MED193:3.567..3.568 Mbp (1.026 kbp) score=20
MED193_17439 COG2186 Transcriptional regulators MED193:3.579..3.579 Mbp (720 bp) score=20
MED193_17539 COG1396 Predicted transcriptional regulators MED193:3.597..3.598 Mbp (792 bp) score=20
MED193_17824 COG1733 Predicted transcriptional regulators MED193:3.655..3.656 Mbp (546 bp) score=20
MED193_17849 transcriptional regulator, Fur family protein MED193:3.66..3.66 Mbp (432 bp) score=20
MED193_18049 probable transcriptional regulator, AraC family protein MED193:3.695..3.696 Mbp (864 bp) score=20
MED193_18289 COG1737 Transcriptional regulators MED193:3.751..3.752 Mbp (897 bp) score=20
MED193_18754 COG1475 Predicted transcriptional regulators MED193:3.845..3.847 Mbp (1.233 kbp) score=20
MED193_18964 COG2378 Predicted transcriptional regulator MED193:3.881..3.882 Mbp (984 bp) score=20
MED193_19444 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain two-component response regulator MED193:3.994..3.994 Mbp (723 bp) score=20
MED193_19474 transcriptional regulator, AraC family protein MED193:3.999..4 Mbp (939 bp) score=20
MED193_19629 COG1349 Transcriptional regulators of sugar metabolism MED193:4.035..4.036 Mbp (798 bp) score=20
MED193_19744 COG1396 Predicted transcriptional regulators MED193:4.057..4.058 Mbp (864 bp) score=20
MED193_20424 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain response regulator MED193:4.192..4.193 Mbp (720 bp) score=20
MED193_20884 transcriptional regulator, LuxR family/sensory box protein MED193:4.282..4.282 Mbp (618 bp) score=20
MED193_21029 COG1475 Predicted transcriptional regulators MED193:4.313..4.314 Mbp (762 bp) score=20
MED193_21134 COG1396 Predicted transcriptional regulators MED193:4.34..4.341 Mbp (831 bp) score=20
MED193_21154 COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain DNA-binding response regulator, LuxR family protein MED193:4.344..4.345 Mbp (645 bp) score=20
MED193_21591 COG1396 Predicted transcriptional regulators MED193:4.426..4.426 Mbp (369 bp) score=20
MED193_21651 COG0583 Transcriptional regulator MED193:4.441..4.442 Mbp (906 bp) score=20
MED193_21696 COG1396 Predicted transcriptional regulators MED193:4.451..4.453 Mbp (1.389 kbp) score=20
MED193_22436 COG1386 Predicted transcriptional regulator containing the HTH domain MED193:4.602..4.603 Mbp (660 bp) score=20
MED193_22541 transcriptional regulator, Fur family protein MED193:4.623..4.623 Mbp (420 bp) score=20
MED193_22686 COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain DNA-binding response regulator, LuxR family protein MED193:4.653..4.654 Mbp (615 bp) score=20
MED193_22761 COG2378 Predicted transcriptional regulator MED193:4.669..4.67 Mbp (732 bp) score=20
MED193_00585 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:124.9..125.9 kbp (1.071 kbp) score=10
MED193_00605 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:129.3..129.8 kbp (546 bp) score=10
MED193_01395 two-component hybrid sensor and regulator MED193:297.8..298.8 kbp (996 bp) score=10
MED193_01590 Chemotaxis response regulator MED193:344.6..344.9 kbp (360 bp) score=10
MED193_01610 chemotaxis regulator protein MED193:348.5..348.9 kbp (375 bp) score=10
MED193_01625 COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain MED193:352.1..353.1 kbp (939 bp) score=10
MED193_01695 two-component hybrid sensor and regulator MED193:367.8..370.1 kbp (2.337 kbp) score=10
MED193_01935 COG1765 Predicted redox protein, regulator of disulfide bond formation MED193:419.6..420.1 kbp (546 bp) score=10
MED193_02045 COG4566 Response regulator MED193:440.4..441 kbp (606 bp) score=10
MED193_02295 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases MED193:484.2..484.8 kbp (615 bp) score=10
MED193_02610 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:540.9..541.5 kbp (615 bp) score=10
MED193_02635 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:544.7..545.8 kbp (1.155 kbp) score=10
MED193_02740 COG0425 Predicted redox protein, regulator of disulfide bond formation MED193:565.6..565.8 kbp (246 bp) score=10
MED193_02935 COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain MED193:602.3..602.9 kbp (633 bp) score=10
MED193_02970 two-component hybrid sensor and regulator MED193:612.2..614.1 kbp (1.86 kbp) score=10
MED193_02975 sensor histidine kinase/response regulator MED193:614.1..614.5 kbp (402 bp) score=10
MED193_03132 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:656.1..656.6 kbp (489 bp) score=10
MED193_03687 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) MED193:765.2..765.9 kbp (717 bp) score=10
MED193_04376 sensory box sensor histidine kianse/response regulator MED193:906.7..909 kbp (2.316 kbp) score=10
MED193_04611 COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains MED193:965.1..966.5 kbp (1.368 kbp) score=10
MED193_04996 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:1.044..1.045 Mbp (594 bp) score=10
MED193_05769 regulatory protein SoxS MED193:1.188..1.189 Mbp (462 bp) score=10
MED193_06914 COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain MED193:1.413..1.414 Mbp (942 bp) score=10
MED193_07568 putative regulatory protein MED193:1.557..1.558 Mbp (900 bp) score=10
MED193_07763 sensory box sensor histidine kinase/response regulator MED193:1.592..1.594 Mbp (2.433 kbp) score=10
MED193_07808 two-component hybrid sensor and regulator MED193:1.606..1.608 Mbp (1.449 kbp) score=10
MED193_08103 transcriptional activator, putative MED193:1.672..1.673 Mbp (636 bp) score=10
MED193_08188 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain MED193:1.689..1.689 Mbp (543 bp) score=10
MED193_09003 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:1.855..1.856 Mbp (867 bp) score=10
MED193_09093 COG3279 Response regulator of the LytR/AlgR family MED193:1.871..1.872 Mbp (750 bp) score=10
MED193_11669 ADA regulatory protein, putative MED193:2.4..2.401 Mbp (1.065 kbp) score=10
MED193_12248 COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) MED193:2.523..2.525 Mbp (1.968 kbp) score=10
MED193_12278 ADA regulatory protein MED193:2.53..2.531 Mbp (864 bp) score=10
MED193_12418 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) MED193:2.558..2.558 Mbp (435 bp) score=10
MED193_12433 COG5499 Predicted transcription regulator containing HTH domain MED193:2.56..2.56 Mbp (390 bp) score=10
MED193_12443 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) MED193:2.562..2.562 Mbp (423 bp) score=10
MED193_12868 sensory box histidine kinase/response regulator MED193:2.649..2.651 Mbp (1.902 kbp) score=10
MED193_12918 COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases MED193:2.658..2.658 Mbp (594 bp) score=10
MED193_13677 regulatory protein SenC MED193:2.813..2.814 Mbp (618 bp) score=10
MED193_13952 response regulator MED193:2.868..2.869 Mbp (1.233 kbp) score=10
MED193_14182 PTS IIA-like nitrogen-regulatory protein PtsN MED193:2.922..2.923 Mbp (465 bp) score=10
MED193_14387 COG1764 Predicted redox protein, regulator of disulfide bond formation MED193:2.964..2.965 Mbp (429 bp) score=10
MED193_14517 COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain MED193:2.991..2.991 Mbp (702 bp) score=10
MED193_14732 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) MED193:3.036..3.037 Mbp (441 bp) score=10
MED193_14737 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) MED193:3.037..3.037 Mbp (339 bp) score=10
MED193_14882 COG5631 Predicted transcription regulator, contains HTH domain (MarR family) MED193:3.069..3.069 Mbp (522 bp) score=10
MED193_15042 sensory box sensor histidine kinase/response regulator MED193:3.105..3.108 Mbp (2.262 kbp) score=10
MED193_15182 sensor histidine kinase/response regulator MED193:3.135..3.137 Mbp (2.349 kbp) score=10
MED193_17299 COG3327 Phenylacetic acid-responsive transcriptional repressor MED193:3.545..3.546 Mbp (792 bp) score=10
MED193_17354 sensory box histidine kinase/response regulator hybrid MED193:3.558..3.56 Mbp (2.076 kbp) score=10
MED193_18239 COG3629 DNA-binding transcriptional activator of the SARP family MED193:3.74..3.741 Mbp (1.584 kbp) score=10
MED193_19244 ATP phosphoribosyltransferase regulatory subunit MED193:3.949..3.95 Mbp (1.044 kbp) score=10
MED193_19439 putative hybrid two-component system regulatory protein MED193:3.991..3.994 Mbp (2.496 kbp) score=10
MED193_19494 sensory box sensor histidine kinase/response regulator MED193:4.003..4.005 Mbp (1.611 kbp) score=10
MED193_19524 sensor histidine kinase with PAS/PAC and Response regulator receiver domains MED193:4.012..4.014 Mbp (2.049 kbp) score=10
MED193_19889 putative regulatory protein MED193:4.08..4.082 Mbp (1.122 kbp) score=10
MED193_21144 COG0440 Acetolactate synthase, small (regulatory) subunit MED193:4.342..4.342 Mbp (561 bp) score=10
MED193_21541 COG3023 Negative regulator of beta-lactamase expression MED193:4.417..4.418 Mbp (744 bp) score=10
MED193_22696 sensory box histidine kinase/response regulator MED193:4.655..4.657 Mbp (2.601 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70