Roseobase: Loktanella sp. SE62

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: LSE62:300000..400000, LSE62_4078, trbJ, transcriptional regulator, MADRDEFAILSAEHVPSRSSFTASTTCSRRNTARHLPRHQP.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 236 regions match your request.
Matches on LSE62
overview_LSE62
LSE62_2892 putative transcriptional regulator transcription regulator protein LSE62:2.829..2.829 Mbp (213 bp) score=30
LSE62_0038 MarR family transcriptional regulator LSE62:39.67..40.23 kbp (561 bp) score=20
LSE62_0060 LysR family transcriptional regulator LSE62:63.53..64.43 kbp (903 bp) score=20
LSE62_0061 putative MerR family transcriptional regulator LSE62:64.56..64.79 kbp (228 bp) score=20
LSE62_0084 MarR family transcriptional regulator LSE62:82.21..82.77 kbp (567 bp) score=20
LSE62_0086 XRE family transcriptional regulator LSE62:83.09..83.48 kbp (393 bp) score=20
LSE62_0091 transcriptional regulator, Fur family LSE62:87.27..87.77 kbp (504 bp) score=20
LSE62_0118 GntR family transcriptional regulator LSE62:110.2..110.9 kbp (654 bp) score=20
metR HTH-type transcriptional regulator MetR LSE62:125.5..126.4 kbp (906 bp) score=20
LSE62_0160 putative XRE family transcriptional regulator LSE62:158..158.4 kbp (438 bp) score=20
LSE62_0165 LysR family transcriptional regulator LSE62:160.6..160.8 kbp (204 bp) score=20
LSE62_0174 periplasmic binding protein/LacI transcriptional regulator LSE62:172..173 kbp (1.008 kbp) score=20
LSE62_0222 XRE family transcriptional regulator LSE62:213.9..215.3 kbp (1.401 kbp) score=20
LSE62_0240 HxlR family transcriptional regulator LSE62:230.5..230.8 kbp (345 bp) score=20
LSE62_0247 XRE family transcriptional regulator LSE62:237.7..238.1 kbp (372 bp) score=20
LSE62_0248 LysR family transcriptional regulator LSE62:239.3..240.2 kbp (876 bp) score=20
LSE62_0274 transcriptional regulator, TetR family LSE62:259.4..260 kbp (588 bp) score=20
LSE62_0324 FUR family transcriptional regulator LSE62:308.7..309.1 kbp (417 bp) score=20
LSE62_0342 TetR family transcriptional regulator LSE62:324.9..325.5 kbp (597 bp) score=20
cueR Cu(I)-responsive transcriptional regulator LSE62:345.3..345.7 kbp (387 bp) score=20
LSE62_0372 transcriptional regulator LSE62:354..355.4 kbp (1.467 kbp) score=20
LSE62_0386 IclR family transcriptional regulator LSE62:369..369.9 kbp (843 bp) score=20
LSE62_0486 AraC family transcriptional regulator LSE62:466.3..467.2 kbp (849 bp) score=20
LSE62_0497 LysR family transcriptional regulator LSE62:473.8..474.7 kbp (882 bp) score=20
LSE62_0528 LysR family transcriptional regulator LSE62:496.4..497.3 kbp (927 bp) score=20
LSE62_0618 autoinducer-binding transcriptional regulator LuxR LSE62:583.9..584.7 kbp (792 bp) score=20
LSE62_0661 GntR family transcriptional regulator LSE62:622.9..623.6 kbp (651 bp) score=20
LSE62_0667 AraC family transcriptional regulator LSE62:632.1..633.1 kbp (948 bp) score=20
LSE62_0679 putative transcriptional regulator LSE62:642.6..643.5 kbp (897 bp) score=20
LSE62_0686 putative LuxR family transcriptional regulator LSE62:649.1..650 kbp (837 bp) score=20
LSE62_0707 LysR family transcriptional regulator LSE62:670.7..671.5 kbp (882 bp) score=20
LSE62_0723 LysR family transcriptional regulator LSE62:686.9..687.8 kbp (897 bp) score=20
LSE62_0731 TetR family transcriptional regulator LSE62:697.8..698.4 kbp (654 bp) score=20
LSE62_0732 AraC family transcriptional regulator LSE62:699.6..700.5 kbp (909 bp) score=20
LSE62_0738 TetR family transcriptional regulator LSE62:707.6..707.7 kbp (138 bp) score=20
LSE62_0743 LysR family transcriptional regulator LSE62:709.8..710.7 kbp (903 bp) score=20
LSE62_0744 GntR family transcriptional regulator LSE62:710.9..712.3 kbp (1.377 kbp) score=20
LSE62_0748 AraC family transcriptional regulator LSE62:714.7..715.7 kbp (996 bp) score=20
LSE62_0773 CopY family transcriptional regulator LSE62:741.3..741.7 kbp (399 bp) score=20
LSE62_0794 transcriptional regulator, AraC family LSE62:761.6..762.5 kbp (921 bp) score=20
LSE62_0797 transcriptional regulatory protein LSE62:763.6..764 kbp (378 bp) score=20
LSE62_0835 two component transcriptional regulator LSE62:796.9..797.6 kbp (687 bp) score=20
LSE62_0848 putative transcriptional regulator LSE62:806.9..807.8 kbp (897 bp) score=20
LSE62_0866 ArsR family transcriptional regulator LSE62:823.9..824.2 kbp (309 bp) score=20
LSE62_0885 periplasmic binding protein/LacI transcriptional regulator LSE62:841.5..841.6 kbp (132 bp) score=20
LSE62_0974 XRE family transcriptional regulator LSE62:919.3..920 kbp (786 bp) score=20
LSE62_0992 transcriptional regulatory protein ChvI LSE62:936.8..937.5 kbp (702 bp) score=20
LSE62_0995 ArsR family transcriptional regulator LSE62:939.6..940.4 kbp (750 bp) score=20
LSE62_1051 AraC family transcriptional regulator LSE62:987.2..988 kbp (825 bp) score=20
LSE62_1068 transcriptional regulatory protein PmrA LSE62:1.008..1.009 Mbp (663 bp) score=20
LSE62_1080 CRP/FNR family transcriptional regulator LSE62:1.026..1.027 Mbp (684 bp) score=20
LSE62_1085 AraC family transcriptional regulator LSE62:1.03..1.031 Mbp (1.098 kbp) score=20
LSE62_1147 transcriptional regulator, MarR family LSE62:1.089..1.09 Mbp (447 bp) score=20
LSE62_1193 LuxR family transcriptional regulator LSE62:1.138..1.141 Mbp (2.622 kbp) score=20
LSE62_1196 AraC family transcriptional regulator LSE62:1.143..1.144 Mbp (765 bp) score=20
LSE62_1232 GntR family transcriptional regulator LSE62:1.183..1.184 Mbp (750 bp) score=20
ppsR transcriptional regulator PpsR LSE62:1.186..1.188 Mbp (1.425 kbp) score=20
LSE62_1253 transcriptional regulator, AraC family LSE62:1.206..1.207 Mbp (909 bp) score=20
LSE62_1276 putative transcriptional regulator LSE62:1.231..1.231 Mbp (345 bp) score=20
LSE62_1290 DeoR family transcriptional regulator LSE62:1.248..1.249 Mbp (963 bp) score=20
LSE62_1295 transcriptional regulator, TetR family LSE62:1.254..1.254 Mbp (573 bp) score=20
LSE62_1378 transcriptional regulator LSE62:1.34..1.34 Mbp (498 bp) score=20
LSE62_1423 MarR family transcriptional regulator LSE62:1.383..1.384 Mbp (444 bp) score=20
LSE62_1475 TetR family transcriptional regulator LSE62:1.44..1.441 Mbp (669 bp) score=20
LSE62_1494 organic hydroperoxide resistance transcriptional regulator LSE62:1.462..1.463 Mbp (438 bp) score=20
LSE62_1497 HTH-type transcriptional regulator PetP LSE62:1.465..1.465 Mbp (474 bp) score=20
LSE62_1571 HTH-type transcriptional regulator RutR LSE62:1.559..1.56 Mbp (615 bp) score=20
LSE62_1582 HxlR family transcriptional regulator LSE62:1.569..1.569 Mbp (411 bp) score=20
LSE62_1727 ArsR family transcriptional regulator LSE62:1.701..1.702 Mbp (300 bp) score=20
LSE62_1785 RpiR family transcriptional regulator LSE62:1.767..1.768 Mbp (921 bp) score=20
LSE62_1864 LysR family transcriptional regulator LSE62:1.873..1.874 Mbp (906 bp) score=20
LSE62_1906 LysR family transcriptional regulator LSE62:1.915..1.916 Mbp (900 bp) score=20
LSE62_1916 Bkd operon transcriptional regulator LSE62:1.922..1.923 Mbp (471 bp) score=20
LSE62_1919 TetR family transcriptional regulator LSE62:1.926..1.927 Mbp (576 bp) score=20
LSE62_1948 TetR family transcriptional regulator LSE62:1.95..1.951 Mbp (591 bp) score=20
LSE62_1950 TetR family transcriptional regulator LSE62:1.952..1.953 Mbp (633 bp) score=20
LSE62_2028 AraC family transcriptional regulator LSE62:2.021..2.022 Mbp (981 bp) score=20
LSE62_2080 transcriptional regulator LSE62:2.066..2.067 Mbp (882 bp) score=20
LSE62_2096 AraC family transcriptional regulator LSE62:2.082..2.083 Mbp (834 bp) score=20
LSE62_2101 TetR family transcriptional regulator LSE62:2.086..2.086 Mbp (576 bp) score=20
LSE62_2102 phosphate regulon transcriptional regulatory protein PhoB LSE62:2.086..2.087 Mbp (690 bp) score=20
LSE62_2107 LysR family transcriptional regulator LSE62:2.092..2.092 Mbp (921 bp) score=20
LSE62_2119 transcriptional regulator, Crp/Fnr family LSE62:2.103..2.104 Mbp (678 bp) score=20
LSE62_2206 transcriptional regulator, AsnC family LSE62:2.19..2.191 Mbp (474 bp) score=20
LSE62_2265 LysR family transcriptional regulator LSE62:2.248..2.249 Mbp (837 bp) score=20
LSE62_2272 MarR family transcriptional regulator LSE62:2.256..2.257 Mbp (435 bp) score=20
LSE62_2402 transcriptional regulator, MerR family LSE62:2.37..2.37 Mbp (417 bp) score=20
LSE62_2478 ROK family transcriptional regulator LSE62:2.44..2.441 Mbp (921 bp) score=20
LSE62_2510 ArsR family transcriptional regulator LSE62:2.488..2.488 Mbp (561 bp) score=20
LSE62_2513 LysR family transcriptional regulator LSE62:2.49..2.491 Mbp (903 bp) score=20
LSE62_2525 AraC family transcriptional regulator LSE62:2.502..2.503 Mbp (747 bp) score=20
LSE62_2565 transcriptional regulator, TetR family LSE62:2.54..2.541 Mbp (702 bp) score=20
LSE62_2566 HxlR family transcriptional regulator LSE62:2.541..2.542 Mbp (405 bp) score=20
LSE62_2617 IclR family transcriptional regulator LSE62:2.581..2.582 Mbp (819 bp) score=20
LSE62_2635 XRE family transcriptional regulator LSE62:2.603..2.603 Mbp (423 bp) score=20
LSE62_2664 TetR family transcriptional regulator LSE62:2.622..2.622 Mbp (609 bp) score=20
LSE62_2683 transcriptional regulator, HxlR family LSE62:2.641..2.642 Mbp (390 bp) score=20
nrdR transcriptional regulator NrdR LSE62:2.643..2.644 Mbp (465 bp) score=20
LSE62_2703 MarR-family transcriptional regulator LSE62:2.655..2.655 Mbp (477 bp) score=20
LSE62_2726 CarD family transcriptional regulator LSE62:2.673..2.674 Mbp (507 bp) score=20
LSE62_2747 TetR family transcriptional regulator LSE62:2.689..2.689 Mbp (639 bp) score=20
LSE62_2750 ArsR family transcriptional regulator LSE62:2.693..2.693 Mbp (468 bp) score=20
LSE62_2769 XRE family transcriptional regulator LSE62:2.706..2.708 Mbp (1.305 kbp) score=20
LSE62_2770 alkaline phosphatase synthesis transcriptional regulatory protein PhoP LSE62:2.708..2.708 Mbp (369 bp) score=20
LSE62_2846 MerR family transcriptional regulator LSE62:2.784..2.784 Mbp (402 bp) score=20
LSE62_2847 MerR family transcriptional regulator LSE62:2.784..2.785 Mbp (369 bp) score=20
LSE62_2855 putative transcriptional regulator LSE62:2.792..2.793 Mbp (891 bp) score=20
LSE62_2863 DeoR family transcriptional regulator LSE62:2.8..2.801 Mbp (804 bp) score=20
LSE62_2884 HTH-type transcriptional regulator GntR LSE62:2.821..2.822 Mbp (999 bp) score=20
LSE62_2939 TetR family transcriptional regulator LSE62:2.873..2.874 Mbp (600 bp) score=20
LSE62_3012 AsnC family transcriptional regulator LSE62:2.938..2.939 Mbp (546 bp) score=20
LSE62_3047 transcriptional regulator, Crp/Fnr family LSE62:2.976..2.977 Mbp (801 bp) score=20
LSE62_3076 transcriptional regulator, TetR family LSE62:3.002..3.002 Mbp (642 bp) score=20
LSE62_3080 DeoR family transcriptional regulator LSE62:3.004..3.005 Mbp (753 bp) score=20
LSE62_3115 transcriptional regulator, DeoR family LSE62:3.036..3.037 Mbp (765 bp) score=20
LSE62_3194 transcriptional regulator, PadR family LSE62:3.108..3.108 Mbp (381 bp) score=20
LSE62_3274 BadM/Rrf2 family transcriptional regulator LSE62:3.183..3.183 Mbp (444 bp) score=20
LSE62_3290 IclR family transcriptional regulator LSE62:3.196..3.197 Mbp (855 bp) score=20
LSE62_3306 IclR family transcriptional regulator LSE62:3.212..3.212 Mbp (726 bp) score=20
LSE62_3369 MerR family transcriptional regulator LSE62:3.275..3.276 Mbp (1.131 kbp) score=20
LSE62_3418 HTH-type transcriptional regulator IscR LSE62:3.32..3.321 Mbp (462 bp) score=20
LSE62_3429 TetR family transcriptional regulator LSE62:3.331..3.331 Mbp (591 bp) score=20
LSE62_3433 LysR family transcriptional regulator LSE62:3.339..3.34 Mbp (927 bp) score=20
LSE62_3441 putative LysR-family transcriptional regulator LSE62:3.347..3.347 Mbp (930 bp) score=20
phnF phosphonate metabolism transcriptional regulator PhnF LSE62:3.388..3.389 Mbp (717 bp) score=20
LSE62_3494 MarR family transcriptional regulator LSE62:3.394..3.394 Mbp (474 bp) score=20
LSE62_3529 GntR family transcriptional regulator LSE62:3.427..3.429 Mbp (1.443 kbp) score=20
LSE62_3541 TetR family transcriptional regulator LSE62:3.437..3.438 Mbp (618 bp) score=20
LSE62_3551 cell cycle transcriptional regulator CtrA LSE62:3.446..3.446 Mbp (717 bp) score=20
LSE62_3566 AsnC family transcriptional regulator LSE62:3.462..3.463 Mbp (477 bp) score=20
LSE62_3600 MarR family transcriptional regulator LSE62:3.505..3.505 Mbp (549 bp) score=20
LSE62_3620 transcriptional regulator, LuxR family LSE62:3.522..3.522 Mbp (546 bp) score=20
LSE62_3627 HTH-type transcriptional regulator AglR LSE62:3.531..3.532 Mbp (1.05 kbp) score=20
LSE62_3634 transcriptional regulator, ArsR family LSE62:3.54..3.54 Mbp (606 bp) score=20
dctD_1 C4-dicarboxylate transport transcriptional regulatory protein DctD LSE62:3.582..3.583 Mbp (1.332 kbp) score=20
LSE62_3703 GntR family transcriptional regulator LSE62:3.602..3.602 Mbp (741 bp) score=20
phoB phosphate regulon transcriptional regulatory protein PhoB LSE62:3.735..3.736 Mbp (687 bp) score=20
LSE62_3834 transcriptional regulator LSE62:3.747..3.748 Mbp (1.002 kbp) score=20
LSE62_3919 HxlR family transcriptional regulator LSE62:3.834..3.834 Mbp (438 bp) score=20
LSE62_3921 transcriptional regulatory protein PrrA LSE62:3.835..3.836 Mbp (672 bp) score=20
LSE62_3935 HxlR family transcriptional regulator LSE62:3.85..3.851 Mbp (405 bp) score=20
LSE62_3982 LysR family transcriptional regulator LSE62:3.893..3.894 Mbp (933 bp) score=20
LSE62_4014 ArsR family transcriptional regulator LSE62:3.931..3.931 Mbp (330 bp) score=20
LSE62_4076 LysR family transcriptional regulator LSE62:3.987..3.988 Mbp (912 bp) score=20
LSE62_4089 LuxR family transcriptional regulator LSE62:3.998..3.999 Mbp (531 bp) score=20
LSE62_4098 LysR family transcriptional regulator LSE62:4.003..4.004 Mbp (912 bp) score=20
LSE62_4106 HxlR family transcriptional regulator LSE62:4.014..4.014 Mbp (483 bp) score=20
LSE62_4143 AraC family transcriptional regulator LSE62:4.055..4.056 Mbp (963 bp) score=20
LSE62_4155 TetR family transcriptional regulator LSE62:4.064..4.065 Mbp (684 bp) score=20
LSE62_4188 LysR family transcriptional regulator LSE62:4.103..4.103 Mbp (825 bp) score=20
dctD_2 C4-dicarboxylate transport transcriptional regulatory protein DctD LSE62:4.113..4.114 Mbp (1.227 kbp) score=20
LSE62_4263 two component transcriptional regulator LSE62:4.168..4.169 Mbp (1.197 kbp) score=20
LSE62_4270 cell cycle transcriptional regulator LSE62:4.175..4.175 Mbp (132 bp) score=20
LSE62_4276 XRE family transcriptional regulator LSE62:4.181..4.181 Mbp (240 bp) score=20
LSE62_4280 phage transcriptional regulator, AlpA LSE62:4.182..4.183 Mbp (282 bp) score=20
LSE62_4349 sarp family transcriptional regulator LSE62:4.268..4.27 Mbp (1.581 kbp) score=20
LSE62_4354 GntR family transcriptional regulator LSE62:4.273..4.274 Mbp (687 bp) score=20
LSE62_4364 AraC family transcriptional regulator LSE62:4.283..4.284 Mbp (870 bp) score=20
LSE62_4402 HTH-type transcriptional regulator PuuR LSE62:4.328..4.329 Mbp (555 bp) score=20
LSE62_4424 periplasmic binding protein/LacI transcriptional regulator LSE62:4.353..4.354 Mbp (1.02 kbp) score=20
prrA transcriptional regulatory protein PrrA LSE62:4.377..4.378 Mbp (702 bp) score=20
LSE62_4465 two component LuxR family transcriptional regulator LSE62:4.394..4.395 Mbp (714 bp) score=20
LSE62_4483 GntR family transcriptional regulator LSE62:4.41..4.411 Mbp (870 bp) score=20
LSE62_4494 GntR family transcriptional regulator LSE62:4.422..4.422 Mbp (708 bp) score=20
LSE62_4501 transcriptional regulator, LysR family LSE62:4.428..4.429 Mbp (942 bp) score=20
LSE62_4527 GntR family transcriptional regulator LSE62:4.467..4.468 Mbp (654 bp) score=20
LSE62_4532 AsnC family transcriptional regulator LSE62:4.471..4.472 Mbp (453 bp) score=20
LSE62_4533 AsnC family transcriptional regulator LSE62:4.472..4.472 Mbp (456 bp) score=20
LSE62_4584 putative LysR family transcriptional regulator LSE62:4.522..4.523 Mbp (225 bp) score=20
LSE62_4585 putative LysR family transcriptional regulator LSE62:4.523..4.524 Mbp (909 bp) score=20
LSE62_4593 HTH-type transcriptional regulator PecS LSE62:4.53..4.531 Mbp (531 bp) score=20
LSE62_4621 TetR family transcriptional regulator LSE62:4.563..4.564 Mbp (576 bp) score=20
lrp_1 leucine-responsive regulatory protein LSE62:35.42..35.89 kbp (465 bp) score=10
LSE62_0046 HTH-type transcriptional activator AmpR LSE62:48.48..49.34 kbp (864 bp) score=10
LSE62_0050 LacI family transcription regulator LSE62:51.89..52.94 kbp (1.053 kbp) score=10
LSE62_0070 regulatory protein ada LSE62:72.28..73.32 kbp (1.032 kbp) score=10
LSE62_0105 transcriptional activator protein FnrL LSE62:97.26..97.97 kbp (708 bp) score=10
lrp_2 leucine-responsive regulatory protein LSE62:117.7..118.2 kbp (492 bp) score=10
betI transcriptional repressor BetI LSE62:221.7..222.3 kbp (585 bp) score=10
LSE62_0282 response regulator PleD LSE62:264..265.3 kbp (1.392 kbp) score=10
LSE62_0298 two-component response regulator LSE62:278.5..279.2 kbp (717 bp) score=10
LSE62_0381 transcription regulator, Cro/CI family -related protein LSE62:365.5..365.7 kbp (219 bp) score=10
cvgS two component sensor kinase/response regulator hybrid LSE62:404.4..406.4 kbp (1.935 kbp) score=10
LSE62_0622 trans-acting regulatory protein HvrA LSE62:590.1..590.4 kbp (342 bp) score=10
LSE62_0814 agr_c_2807p, transcription regulator aglr LSE62:778.5..779.5 kbp (1.071 kbp) score=10
LSE62_0826 HTH-type transcriptional activator HxlR LSE62:789..789.3 kbp (354 bp) score=10
LSE62_1131 transcriptional activator ChrR LSE62:1.076..1.077 Mbp (663 bp) score=10
LSE62_1299 LacI family transcription regulator LSE62:1.26..1.261 Mbp (1.023 kbp) score=10
LSE62_1302 response regulator receiver protein LSE62:1.264..1.265 Mbp (648 bp) score=10
LSE62_1307 sensory box histidine kinase/response regulator hybrid LSE62:1.269..1.27 Mbp (1.308 kbp) score=10
LSE62_1356 ahcy transcriptional activator hvrb LSE62:1.315..1.316 Mbp (876 bp) score=10
LSE62_1357 photosynthetic apparatus regulatory protein RegA LSE62:1.316..1.317 Mbp (552 bp) score=10
LSE62_1453 nitrogen regulatory protein LSE62:1.418..1.419 Mbp (465 bp) score=10
LSE62_1679 flagellar biosynthesis regulatory protein FlaF LSE62:1.658..1.658 Mbp (375 bp) score=10
LSE62_1794 galactonate operon transcriptional repressor LSE62:1.778..1.779 Mbp (735 bp) score=10
LSE62_1891 nitrogen regulatory protein P-II LSE62:1.902..1.903 Mbp (339 bp) score=10
LSE62_1964 glutamate uptake regulatory protein LSE62:1.962..1.962 Mbp (462 bp) score=10
LSE62_2058 response regulator LSE62:2.048..2.048 Mbp (399 bp) score=10
LSE62_2112 putative Two-component response regulator ARR3 LSE62:2.096..2.097 Mbp (135 bp) score=10
LSE62_2210 ATP phosphoribosyltransferase regulatory subunit LSE62:2.194..2.196 Mbp (1.449 kbp) score=10
lrp_3 leucine-responsive regulatory protein LSE62:2.238..2.238 Mbp (501 bp) score=10
LSE62_2299 response regulator receiver protein LSE62:2.281..2.282 Mbp (747 bp) score=10
LSE62_2308 response regulator receiver protein LSE62:2.292..2.293 Mbp (1.245 kbp) score=10
LSE62_2416 putative two-component system regulatory protein LSE62:2.385..2.386 Mbp (1.005 kbp) score=10
LSE62_2433 putative sensory box histidine kinase/response regulator LSE62:2.399..2.399 Mbp (627 bp) score=10
LSE62_2454 response regulator receiver domain-containing protein LSE62:2.415..2.416 Mbp (384 bp) score=10
LSE62_2560 response regulator LSE62:2.538..2.538 Mbp (717 bp) score=10
LSE62_2592 GcrA cell cycle regulator LSE62:2.558..2.559 Mbp (609 bp) score=10
LSE62_2629 prophage CP4-57 regulatory LSE62:2.594..2.594 Mbp (588 bp) score=10
LSE62_2873 chemotaxis response regulator protein-glutamate methylesterase of group 1 operon LSE62:2.812..2.813 Mbp (993 bp) score=10
LSE62_2879 response regulator receiver protein LSE62:2.818..2.818 Mbp (369 bp) score=10
LSE62_3044 phyllosphere-induced regulator PhyR LSE62:2.974..2.975 Mbp (816 bp) score=10
LSE62_3061 DNA-binding response regulator TctD LSE62:2.988..2.988 Mbp (795 bp) score=10
LSE62_3229 response regulator receiver protein LSE62:3.143..3.144 Mbp (468 bp) score=10
LSE62_3239 nitrogen regulatory protein P-II LSE62:3.152..3.152 Mbp (339 bp) score=10
LSE62_3367 PleD-related family two-component system response regulator LSE62:3.272..3.273 Mbp (1.458 kbp) score=10
LSE62_3458 putative transcription regulator protein LSE62:3.363..3.364 Mbp (699 bp) score=10
LSE62_3464 response regulator receiver modulated GAF sensor protein LSE62:3.371..3.373 Mbp (2.58 kbp) score=10
LSE62_3624 sensory box sensor histidine kianse/response regulator LSE62:3.526..3.528 Mbp (2.337 kbp) score=10
LSE62_3700 putative response regulator receiver domain-containing protein LSE62:3.599..3.6 Mbp (852 bp) score=10
LSE62_3779 ATP-dependent transcription regulator LuxR LSE62:3.686..3.687 Mbp (756 bp) score=10
phoU phosphate transport system regulatory protein PhoU LSE62:3.736..3.737 Mbp (708 bp) score=10
LSE62_3848 nitrogen assimilation regulatory protein NtrX LSE62:3.761..3.763 Mbp (1.404 kbp) score=10
LSE62_3914 agr_c_2807p, transcription regulator aglr LSE62:3.828..3.829 Mbp (1.023 kbp) score=10
LSE62_3936 HTH-type transcriptional activator HxlR LSE62:3.85..3.85 Mbp (360 bp) score=10
LSE62_3947 LacI family transcription regulator LSE62:3.862..3.863 Mbp (486 bp) score=10
LSE62_3989 response regulator RpfG LSE62:3.901..3.902 Mbp (1.047 kbp) score=10
LSE62_3991 hybrid sensor and regulator fused LSE62:3.903..3.905 Mbp (2.172 kbp) score=10
soxR redox-sensitive transcriptional activator SoxR LSE62:3.934..3.934 Mbp (444 bp) score=10
LSE62_4024 regulatory protein ada LSE62:3.936..3.937 Mbp (1.062 kbp) score=10
LSE62_4166 transcription regulator LSE62:4.078..4.079 Mbp (525 bp) score=10
LSE62_4174 putative negative amidase regulator, AmiC LSE62:4.086..4.087 Mbp (1.101 kbp) score=10
LSE62_4206 glutamate uptake regulatory protein LSE62:4.119..4.119 Mbp (462 bp) score=10
LSE62_4383 response regulator receiver/antar domain-containing protein LSE62:4.304..4.304 Mbp (621 bp) score=10
LSE62_4441 LacI family transcription regulator LSE62:4.373..4.374 Mbp (1.077 kbp) score=10
LSE62_4536 regulatory protein ArsR LSE62:4.474..4.474 Mbp (681 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70