Roseobase:Jannaschia sp. CCS1

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: Jann:48..1475, Jann_4283, recF, YP_512158, Jann_R0021, Jann_R0043, transcriptional regulator, IAHTLMADRFGLDIGAGLEQPIDIQKGDIFLRLDLDPECPMPALTEIQRMRRHGVKVFNV.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 275 regions match your request.
Matches on Jann
overview_Jann
Jann_0025 transcriptional regulator Jann:24..24.26 kbp (258 bp) score=20
Jann_0050 TetR family transcriptional regulator Jann:45.58..46.21 kbp (633 bp) score=20
Jann_0092 two component transcriptional regulator Jann:86.92..87.64 kbp (720 bp) score=20
Jann_0093 MarR family transcriptional regulator Jann:87.64..88.15 kbp (510 bp) score=20
Jann_0095 LysR family transcriptional regulator Jann:90.08..90.96 kbp (876 bp) score=20
Jann_0097 TetR family transcriptional regulator Jann:91.59..92.16 kbp (567 bp) score=20
Jann_0127 LysR family transcriptional regulator Jann:117.1..117.9 kbp (888 bp) score=20
Jann_0259 MarR family transcriptional regulator Jann:260.2..260.7 kbp (435 bp) score=20
Jann_0280 LysR family transcriptional regulator Jann:286.1..287 kbp (906 bp) score=20
Jann_0297 MarR family transcriptional regulator Jann:304..304.5 kbp (444 bp) score=20
Jann_0311 LacI family transcriptional regulator Jann:318.5..319.6 kbp (1.023 kbp) score=20
Jann_0320 negative transcriptional regulator Jann:327.8..328.4 kbp (654 bp) score=20
Jann_0361 putative transcriptional regulator Jann:365.2..365.6 kbp (420 bp) score=20
Jann_0375 XRE family transcriptional regulator Jann:381.7..381.9 kbp (231 bp) score=20
Jann_0417 two component transcriptional regulator Jann:420.5..421.2 kbp (687 bp) score=20
Jann_0459 AsnC family transcriptional regulator Jann:460.8..461.3 kbp (483 bp) score=20
Jann_0491 Glycine cleavage system transcriptional activator; activates the gcvTHP operon in the presence of glycine and represses the operon in its absence DNA-binding transcriptional activator GcvA Jann:488.9..489.9 kbp (948 bp) score=20
Jann_0509 TetR family transcriptional regulator Jann:504.5..505.1 kbp (576 bp) score=20
Jann_0536 two component transcriptional regulator Jann:526.7..527.4 kbp (702 bp) score=20
Jann_0562 ArsR family transcriptional regulator Jann:548.5..548.8 kbp (348 bp) score=20
Jann_0619 LuxR family transcriptional regulator Jann:592.8..593.4 kbp (612 bp) score=20
Jann_0660 MarR family transcriptional regulator Jann:630.9..631.5 kbp (528 bp) score=20
Jann_0666 MarR family transcriptional regulator Jann:636.5..637.1 kbp (510 bp) score=20
Jann_0675 anaerobic benzoate catabolism transcriptional regulator Jann:646.5..647.4 kbp (894 bp) score=20
Jann_0712 ArsR family transcriptional regulator Jann:684.8..685.1 kbp (366 bp) score=20
Jann_0718 TetR family transcriptional regulator Jann:687.7..688.4 kbp (645 bp) score=20
Jann_0722 LysR family transcriptional regulator Jann:692.9..693.8 kbp (885 bp) score=20
Jann_0729 LysR family transcriptional regulator Jann:698.9..699.8 kbp (891 bp) score=20
Jann_0732 AraC family transcriptional regulator Jann:701.7..702.7 kbp (996 bp) score=20
Jann_0761 LysR family transcriptional regulator Jann:724.1..725 kbp (921 bp) score=20
Jann_0765 ArsR family transcriptional regulator Jann:727.4..727.8 kbp (438 bp) score=20
Jann_0838 GntR family transcriptional regulator Jann:793.8..794.5 kbp (654 bp) score=20
Jann_0876 GntR family transcriptional regulator Jann:832.5..833.1 kbp (663 bp) score=20
Jann_0882 periplasmic binding protein/LacI transcriptional regulator Jann:837.5..837.6 kbp (72 bp) score=20
Jann_0887 LysR family transcriptional regulator Jann:842.2..843.1 kbp (921 bp) score=20
Jann_0939 ArsR family transcriptional regulator Jann:895.4..895.7 kbp (336 bp) score=20
Jann_1027 LysR family transcriptional regulator Jann:979.8..980.7 kbp (909 bp) score=20
Jann_1079 LysR family transcriptional regulator Jann:1.041..1.042 Mbp (894 bp) score=20
Jann_1101 ArsR family transcriptional regulator Jann:1.062..1.062 Mbp (744 bp) score=20
Jann_1107 LacI family transcriptional regulator Jann:1.068..1.069 Mbp (1.038 kbp) score=20
Jann_1153 LuxR family transcriptional regulator Jann:1.115..1.116 Mbp (732 bp) score=20
Jann_1164 GntR family transcriptional regulator Jann:1.13..1.131 Mbp (657 bp) score=20
Jann_1168 LysR family transcriptional regulator Jann:1.133..1.134 Mbp (894 bp) score=20
Jann_1230 LysR family transcriptional regulator Jann:1.186..1.187 Mbp (855 bp) score=20
Jann_1232 XRE family transcriptional regulator Jann:1.188..1.189 Mbp (381 bp) score=20
Jann_1239 AsnC family transcriptional regulator Jann:1.195..1.195 Mbp (456 bp) score=20
Jann_1240 AsnC family transcriptional regulator Jann:1.195..1.196 Mbp (456 bp) score=20
Jann_1244 GntR family transcriptional regulator Jann:1.199..1.2 Mbp (636 bp) score=20
Jann_1253 LytR/AlgR family transcriptional regulator Jann:1.208..1.209 Mbp (882 bp) score=20
Jann_1260 LysR family transcriptional regulator Jann:1.219..1.22 Mbp (879 bp) score=20
Jann_1265 LysR family transcriptional regulator Jann:1.225..1.226 Mbp (885 bp) score=20
Jann_1282 LacI family transcriptional regulator Jann:1.243..1.244 Mbp (1.059 kbp) score=20
Jann_1294 AraC family transcriptional regulator Jann:1.255..1.256 Mbp (759 bp) score=20
Jann_1299 TetR family transcriptional regulator Jann:1.258..1.259 Mbp (609 bp) score=20
Jann_1309 TetR family transcriptional regulator Jann:1.269..1.27 Mbp (669 bp) score=20
Jann_1317 LysR family transcriptional regulator Jann:1.282..1.283 Mbp (927 bp) score=20
Jann_1318 AraC family transcriptional regulator Jann:1.283..1.283 Mbp (885 bp) score=20
Jann_1325 MarR family transcriptional regulator Jann:1.29..1.291 Mbp (474 bp) score=20
Jann_1331 MarR family transcriptional regulator Jann:1.295..1.296 Mbp (450 bp) score=20
Jann_1341 MarR family transcriptional regulator Jann:1.307..1.308 Mbp (471 bp) score=20
Jann_1347 LacI family transcriptional regulator Jann:1.312..1.313 Mbp (1.026 kbp) score=20
Jann_1359 GntR family transcriptional regulator Jann:1.323..1.324 Mbp (750 bp) score=20
Jann_1373 periplasmic binding protein/LacI transcriptional regulator Jann:1.342..1.343 Mbp (1.029 kbp) score=20
Jann_1392 GntR family transcriptional regulator Jann:1.362..1.363 Mbp (675 bp) score=20
Jann_1397 LacI family transcriptional regulator Jann:1.367..1.368 Mbp (1.023 kbp) score=20
Jann_1405 GntR family transcriptional regulator Jann:1.374..1.375 Mbp (669 bp) score=20
Jann_1407 LysR family transcriptional regulator Jann:1.377..1.378 Mbp (1.035 kbp) score=20
Jann_1409 putative transcriptional regulator Jann:1.379..1.379 Mbp (537 bp) score=20
Jann_1424 LacI family transcriptional regulator Jann:1.394..1.395 Mbp (999 bp) score=20
Jann_1425 periplasmic binding protein/LacI transcriptional regulator Jann:1.395..1.396 Mbp (951 bp) score=20
Jann_1444 IclR family transcriptional regulator Jann:1.413..1.414 Mbp (666 bp) score=20
Jann_1459 LacI family transcriptional regulator Jann:1.428..1.429 Mbp (1.023 kbp) score=20
Jann_1479 TetR family transcriptional regulator Jann:1.448..1.449 Mbp (696 bp) score=20
Jann_1496 TetR family transcriptional regulator Jann:1.467..1.468 Mbp (573 bp) score=20
Jann_1519 AsnC family transcriptional regulator Jann:1.49..1.49 Mbp (504 bp) score=20
Jann_1522 AsnC family transcriptional regulator Jann:1.492..1.492 Mbp (453 bp) score=20
Jann_1524 LysR family transcriptional regulator Jann:1.494..1.495 Mbp (909 bp) score=20
Jann_1527 TetR family transcriptional regulator Jann:1.496..1.497 Mbp (615 bp) score=20
Jann_1538 LuxR family transcriptional regulator Jann:1.508..1.509 Mbp (1.158 kbp) score=20
Jann_1542 phage transcriptional regulator, AlpA Jann:1.512..1.513 Mbp (231 bp) score=20
Jann_1550 TetR family transcriptional regulator Jann:1.521..1.522 Mbp (645 bp) score=20
Jann_1552 LysR family transcriptional regulator Jann:1.523..1.524 Mbp (864 bp) score=20
Jann_1555 AraC family transcriptional regulator Jann:1.526..1.527 Mbp (1.158 kbp) score=20
Jann_1562 LacI family transcriptional regulator Jann:1.538..1.539 Mbp (1.017 kbp) score=20
Jann_1578 SARP family transcriptional regulator Jann:1.559..1.561 Mbp (1.593 kbp) score=20
Jann_1585 LysR family transcriptional regulator Jann:1.566..1.567 Mbp (921 bp) score=20
Jann_1595 LysR family transcriptional regulator Jann:1.577..1.578 Mbp (846 bp) score=20
Jann_1666 GntR family transcriptional regulator Jann:1.651..1.651 Mbp (768 bp) score=20
Jann_1668 transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase Jann:1.652..1.653 Mbp (804 bp) score=20
Jann_1710 lysine decarboxylase transcriptional regulator CadC Jann:1.691..1.693 Mbp (1.242 kbp) score=20
Jann_1730 two component sigma54 specific Fis family transcriptional regulator Jann:1.722..1.723 Mbp (1.344 kbp) score=20
Jann_1776 AsnC family transcriptional regulator Jann:1.764..1.765 Mbp (534 bp) score=20
Jann_1782 MerR family transcriptional regulator Jann:1.771..1.772 Mbp (801 bp) score=20
Jann_1862 transcriptional regulator BolA Jann:1.849..1.85 Mbp (261 bp) score=20
Jann_1914 LysR family transcriptional regulator Jann:1.904..1.905 Mbp (903 bp) score=20
Jann_1940 GntR family transcriptional regulator Jann:1.931..1.931 Mbp (735 bp) score=20
Jann_1945 LacI family transcriptional regulator Jann:1.936..1.937 Mbp (1.035 kbp) score=20
Jann_1952 AraC family transcriptional regulator Jann:1.945..1.946 Mbp (816 bp) score=20
Jann_2008 AsnC family transcriptional regulator Jann:2.015..2.015 Mbp (522 bp) score=20
Jann_2012 TetR family transcriptional regulator Jann:2.018..2.019 Mbp (588 bp) score=20
Jann_2014 two component transcriptional regulator Jann:2.02..2.021 Mbp (720 bp) score=20
Jann_2021 LysR family transcriptional regulator Jann:2.024..2.025 Mbp (900 bp) score=20
Jann_2033 LuxR family transcriptional regulator Jann:2.039..2.04 Mbp (738 bp) score=20
Jann_2034 TetR family transcriptional regulator Jann:2.04..2.041 Mbp (651 bp) score=20
Jann_2046 XRE family transcriptional regulator Jann:2.05..2.051 Mbp (618 bp) score=20
Jann_2050 AraC family transcriptional regulator Jann:2.055..2.056 Mbp (855 bp) score=20
Jann_2071 DeoR family transcriptional regulator Jann:2.08..2.081 Mbp (765 bp) score=20
Jann_2087 MerR family transcriptional regulator Jann:2.097..2.098 Mbp (387 bp) score=20
Jann_2099 ArsR family transcriptional regulator Jann:2.109..2.109 Mbp (333 bp) score=20
Jann_2107 GntR family transcriptional regulator Jann:2.116..2.117 Mbp (735 bp) score=20
Jann_2156 MarR family transcriptional regulator Jann:2.165..2.165 Mbp (450 bp) score=20
Jann_2175 LysR family transcriptional regulator Jann:2.181..2.182 Mbp (915 bp) score=20
Jann_2203 CopG family transcriptional regulator Jann:2.213..2.213 Mbp (417 bp) score=20
Jann_2238 two component sigma54 specific Fis family transcriptional regulator Jann:2.243..2.244 Mbp (1.38 kbp) score=20
Jann_2240 two component sigma54 specific Fis family transcriptional regulator Jann:2.247..2.248 Mbp (1.398 kbp) score=20
Jann_2256 BadM/Rrf2 family transcriptional regulator Jann:2.263..2.263 Mbp (411 bp) score=20
Jann_2258 SARP family transcriptional regulator Jann:2.264..2.266 Mbp (1.944 kbp) score=20
Jann_2273 MarR family transcriptional regulator Jann:2.28..2.28 Mbp (480 bp) score=20
Jann_2294 two component transcriptional regulator Jann:2.301..2.301 Mbp (687 bp) score=20
Jann_2301 LuxR family transcriptional regulator Jann:2.306..2.307 Mbp (804 bp) score=20
Jann_2314 XRE family transcriptional regulator Jann:2.319..2.319 Mbp (627 bp) score=20
Jann_2354 TetR family transcriptional regulator Jann:2.36..2.361 Mbp (618 bp) score=20
Jann_2366 BadM/Rrf2 family transcriptional regulator Jann:2.371..2.372 Mbp (459 bp) score=20
Jann_2377 AsnC family transcriptional regulator Jann:2.381..2.382 Mbp (417 bp) score=20
Jann_2385 GntR family transcriptional regulator Jann:2.387..2.388 Mbp (780 bp) score=20
Jann_2389 GntR family transcriptional regulator Jann:2.391..2.392 Mbp (678 bp) score=20
Jann_2406 periplasmic binding protein/LacI transcriptional regulator Jann:2.408..2.408 Mbp (66 bp) score=20
Jann_2408 LysR family transcriptional regulator Jann:2.41..2.411 Mbp (885 bp) score=20
Jann_2412 ArsR family transcriptional regulator Jann:2.413..2.413 Mbp (441 bp) score=20
Jann_2416 TetR family transcriptional regulator Jann:2.415..2.415 Mbp (579 bp) score=20
Jann_2417 BadM/Rrf2 family transcriptional regulator Jann:2.416..2.416 Mbp (426 bp) score=20
Jann_2424 TetR family transcriptional regulator Jann:2.42..2.42 Mbp (588 bp) score=20
Jann_2444 transcriptional regulator Jann:2.436..2.437 Mbp (996 bp) score=20
Jann_2462 AraC family transcriptional regulator Jann:2.456..2.457 Mbp (807 bp) score=20
Jann_2505 two component transcriptional regulator Jann:2.506..2.506 Mbp (717 bp) score=20
Jann_2511 MerR family transcriptional regulator Jann:2.511..2.511 Mbp (360 bp) score=20
Jann_2521 LysR family transcriptional regulator Jann:2.522..2.522 Mbp (63 bp) score=20
Jann_2541 two component sigma54 specific Fis family transcriptional regulator Jann:2.545..2.546 Mbp (1.317 kbp) score=20
Jann_2561 LysR family transcriptional regulator Jann:2.563..2.564 Mbp (894 bp) score=20
Jann_2571 LysR family transcriptional regulator Jann:2.579..2.579 Mbp (879 bp) score=20
Jann_2581 AraC family transcriptional regulator Jann:2.591..2.592 Mbp (978 bp) score=20
Jann_2593 DeoR family transcriptional regulator Jann:2.606..2.607 Mbp (837 bp) score=20
Jann_2610 LysR family transcriptional regulator Jann:2.626..2.627 Mbp (879 bp) score=20
Jann_2619 TetR family transcriptional regulator Jann:2.639..2.639 Mbp (585 bp) score=20
Jann_2631 TetR family transcriptional regulator Jann:2.647..2.648 Mbp (594 bp) score=20
Jann_2651 MarR family transcriptional regulator Jann:2.665..2.665 Mbp (498 bp) score=20
Jann_2653 XRE family transcriptional regulator Jann:2.666..2.666 Mbp (402 bp) score=20
Jann_2656 TetR family transcriptional regulator Jann:2.668..2.669 Mbp (540 bp) score=20
Jann_2681 TraR/DksA family transcriptional regulator Jann:2.692..2.692 Mbp (480 bp) score=20
Jann_2696 XRE family transcriptional regulator Jann:2.707..2.708 Mbp (1.323 kbp) score=20
Jann_2710 TetR family transcriptional regulator Jann:2.72..2.72 Mbp (612 bp) score=20
Jann_2774 AsnC family transcriptional regulator Jann:2.79..2.791 Mbp (453 bp) score=20
Jann_2850 GntR family transcriptional regulator Jann:2.869..2.871 Mbp (1.488 kbp) score=20
Jann_2856 GntR family transcriptional regulator Jann:2.876..2.877 Mbp (717 bp) score=20
Jann_2877 LysR family transcriptional regulator Jann:2.897..2.898 Mbp (945 bp) score=20
Jann_2901 LacI family transcriptional regulator Jann:2.921..2.922 Mbp (1.032 kbp) score=20
Jann_2915 GntR family transcriptional regulator Jann:2.938..2.938 Mbp (669 bp) score=20
Jann_2940 LysR family transcriptional regulator Jann:2.963..2.964 Mbp (906 bp) score=20
Jann_2950 TetR family transcriptional regulator Jann:2.973..2.973 Mbp (654 bp) score=20
Jann_2968 MerR family transcriptional regulator Jann:2.987..2.987 Mbp (366 bp) score=20
Jann_2969 MerR family transcriptional regulator Jann:2.988..2.988 Mbp (393 bp) score=20
Jann_2994 TetR family transcriptional regulator Jann:3.014..3.015 Mbp (594 bp) score=20
Jann_2996 TetR family transcriptional regulator Jann:3.016..3.017 Mbp (582 bp) score=20
Jann_3009 AbrB family transcriptional regulator Jann:3.029..3.029 Mbp (240 bp) score=20
Jann_3056 putative transcriptional regulator Jann:3.088..3.088 Mbp (300 bp) score=20
Jann_3060 periplasmic binding protein/LacI transcriptional regulator Jann:3.092..3.093 Mbp (858 bp) score=20
Jann_3067 transcriptional regulator NanR Jann:3.1..3.101 Mbp (777 bp) score=20
Jann_3086 LuxR family transcriptional regulator Jann:3.12..3.121 Mbp (879 bp) score=20
Jann_3087 periplasmic binding protein/LacI transcriptional regulator Jann:3.121..3.122 Mbp (1.032 kbp) score=20
Jann_3091 LacI family transcriptional regulator Jann:3.126..3.127 Mbp (987 bp) score=20
Jann_3094 periplasmic binding protein/LacI transcriptional regulator Jann:3.131..3.131 Mbp (72 bp) score=20
Jann_3095 AraC family transcriptional regulator Jann:3.131..3.132 Mbp (942 bp) score=20
Jann_3097 AraC family transcriptional regulator Jann:3.134..3.135 Mbp (813 bp) score=20
Jann_3102 MarR family transcriptional regulator Jann:3.139..3.139 Mbp (336 bp) score=20
Jann_3105 TetR family transcriptional regulator Jann:3.14..3.14 Mbp (663 bp) score=20
Jann_3140 XRE family transcriptional regulator Jann:3.179..3.179 Mbp (93 bp) score=20
Jann_3193 LuxR family transcriptional regulator Jann:3.235..3.236 Mbp (732 bp) score=20
Jann_3249 LysR family transcriptional regulator Jann:3.299..3.3 Mbp (894 bp) score=20
Jann_3261 IclR family transcriptional regulator Jann:3.313..3.314 Mbp (855 bp) score=20
Jann_3299 TetR family transcriptional regulator Jann:3.353..3.354 Mbp (615 bp) score=20
Jann_3308 CarD family transcriptional regulator Jann:3.363..3.363 Mbp (519 bp) score=20
Jann_3337 AsnC family transcriptional regulator Jann:3.389..3.389 Mbp (501 bp) score=20
Jann_3342 LuxR family transcriptional regulator Jann:3.394..3.395 Mbp (756 bp) score=20
Jann_3376 XRE family transcriptional regulator Jann:3.429..3.431 Mbp (1.41 kbp) score=20
Jann_3394 LuxR family transcriptional regulator Jann:3.447..3.448 Mbp (1.05 kbp) score=20
Jann_3404 LysR family transcriptional regulator Jann:3.455..3.456 Mbp (921 bp) score=20
Jann_3407 ArsR family transcriptional regulator Jann:3.457..3.458 Mbp (333 bp) score=20
nrdR transcriptional regulator NrdR Jann:3.471..3.471 Mbp (471 bp) score=20
Jann_3452 transcriptional regulator/antitoxin MazE Jann:3.501..3.501 Mbp (297 bp) score=20
Jann_3482 AraC family transcriptional regulator Jann:3.535..3.536 Mbp (900 bp) score=20
Jann_3484 MarR family transcriptional regulator Jann:3.537..3.537 Mbp (330 bp) score=20
Jann_3491 two component transcriptional regulator Jann:3.545..3.545 Mbp (660 bp) score=20
Jann_3495 AsnC family transcriptional regulator Jann:3.551..3.552 Mbp (531 bp) score=20
Jann_3505 MarR family transcriptional regulator Jann:3.561..3.561 Mbp (438 bp) score=20
Jann_3511 IclR family transcriptional regulator Jann:3.567..3.568 Mbp (819 bp) score=20
Jann_3515 two component LuxR family transcriptional regulator Jann:3.571..3.572 Mbp (645 bp) score=20
Jann_3528 SARP family transcriptional regulator Jann:3.586..3.587 Mbp (1.62 kbp) score=20
Jann_3536 XRE family transcriptional regulator Jann:3.594..3.596 Mbp (1.746 kbp) score=20
Jann_3545 LuxR family transcriptional regulator Jann:3.609..3.61 Mbp (1.185 kbp) score=20
Jann_3551 GntR family transcriptional regulator Jann:3.615..3.615 Mbp (765 bp) score=20
Jann_3653 ArsR family transcriptional regulator Jann:3.727..3.727 Mbp (336 bp) score=20
Jann_3668 negative transcriptional regulator Jann:3.745..3.745 Mbp (756 bp) score=20
Jann_3669 transcriptional regulator-like protein Jann:3.746..3.747 Mbp (1.584 kbp) score=20
Jann_3675 MerR family transcriptional regulator Jann:3.752..3.753 Mbp (813 bp) score=20
Jann_3676 IclR family transcriptional regulator Jann:3.753..3.754 Mbp (783 bp) score=20
Jann_3696 LysR family transcriptional regulator Jann:3.779..3.78 Mbp (939 bp) score=20
Jann_3698 LysR family transcriptional regulator Jann:3.78..3.781 Mbp (963 bp) score=20
Jann_3704 GntR family transcriptional regulator Jann:3.789..3.789 Mbp (690 bp) score=20
Jann_3712 transcriptional regulator Jann:3.797..3.798 Mbp (1.011 kbp) score=20
Jann_3721 transcriptional regulator-like protein Jann:3.806..3.807 Mbp (1.548 kbp) score=20
Jann_3731 AraC family transcriptional regulator Jann:3.814..3.814 Mbp (762 bp) score=20
Jann_3736 AraC family transcriptional regulator Jann:3.819..3.82 Mbp (1.014 kbp) score=20
Jann_3737 MarR family transcriptional regulator Jann:3.821..3.821 Mbp (480 bp) score=20
Jann_3744 LysR family transcriptional regulator Jann:3.825..3.826 Mbp (915 bp) score=20
Jann_3756 LysR family transcriptional regulator Jann:3.838..3.838 Mbp (906 bp) score=20
Jann_3762 GntR family transcriptional regulator Jann:3.844..3.845 Mbp (795 bp) score=20
Jann_3781 MarR family transcriptional regulator Jann:3.865..3.866 Mbp (495 bp) score=20
Jann_3788 GntR family transcriptional regulator Jann:3.872..3.873 Mbp (717 bp) score=20
Jann_3795 IclR family transcriptional regulator Jann:3.882..3.882 Mbp (744 bp) score=20
Jann_3802 RpiR family transcriptional regulator Jann:3.887..3.888 Mbp (921 bp) score=20
Jann_3810 LysR family transcriptional regulator Jann:3.897..3.897 Mbp (882 bp) score=20
Jann_3821 transcriptional regulator Jann:3.913..3.914 Mbp (936 bp) score=20
Jann_3839 IclR family transcriptional regulator Jann:3.934..3.935 Mbp (795 bp) score=20
Jann_3858 Crp/FNR family transcriptional regulator Jann:3.954..3.955 Mbp (747 bp) score=20
Jann_3927 LacI family transcriptional regulator Jann:4.023..4.024 Mbp (1.005 kbp) score=20
Jann_3945 MarR family transcriptional regulator Jann:4.045..4.046 Mbp (438 bp) score=20
Jann_3950 IclR family transcriptional regulator Jann:4.05..4.05 Mbp (804 bp) score=20
Jann_3953 LysR family transcriptional regulator Jann:4.053..4.054 Mbp (966 bp) score=20
Jann_3973 LysR family transcriptional regulator Jann:4.07..4.071 Mbp (891 bp) score=20
Jann_3975 AraC family transcriptional regulator Jann:4.075..4.076 Mbp (999 bp) score=20
Jann_4014 two component transcriptional regulator Jann:4.118..4.119 Mbp (705 bp) score=20
Jann_4071 LysR family transcriptional regulator Jann:4.178..4.179 Mbp (906 bp) score=20
Jann_4133 GntR family transcriptional regulator Jann:4.243..4.244 Mbp (696 bp) score=20
Jann_4140 GntR family transcriptional regulator Jann:4.25..4.251 Mbp (660 bp) score=20
Jann_4152 LysR family transcriptional regulator Jann:4.264..4.265 Mbp (915 bp) score=20
Jann_4160 LysR family transcriptional regulator Jann:4.271..4.272 Mbp (894 bp) score=20
Jann_4166 TetR family transcriptional regulator Jann:4.275..4.276 Mbp (576 bp) score=20
Jann_0071 response regulator receiver (CheY-like) modulated serine phosphatase Jann:65.17..66.44 kbp (1.281 kbp) score=10
Jann_0110 nitrogen regulatory protein P-II Jann:100.3..100.6 kbp (312 bp) score=10
hrcA Negative regulator of class I heat shock genes (grpE-dnaK-dnaJ and groELS operons). Prevents heat-shock induction of these operons Jann:198.3..199.4 kbp (1.065 kbp) score=10
Jann_0223 PTS transporter subunit IIA-like nitrogen-regulatory protein PtsN Jann:219.2..219.7 kbp (465 bp) score=10
Jann_0313 ferric uptake regulator family protein Jann:320.9..321.4 kbp (519 bp) score=10
Jann_0388 response regulator receiver domain-containing protein Jann:392.3..393 kbp (702 bp) score=10
rpmE RpmE; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially growing Bacilli while YtiA was found after exponential growth; expression of ytiA is controlled by a zinc-specific transcriptional repressor; RpmE contains one zinc ion and a CxxC motif is responsible for this binding; forms an RNP particle along with proteins L5, L18, and L25 and 5S rRNA; found crosslinked to L2 and L25 and EF-G; may be near the peptidyltransferase site of the 50S ribosome Jann:711.8..712 kbp (222 bp) score=10
Jann_0897 catalyzes the uridylylation or deuridylylation of the PII nitrogen regulatory protein Jann:851.6..854.3 kbp (2.745 kbp) score=10
Jann_1020 GcrA cell cycle regulator Jann:973.2..973.8 kbp (588 bp) score=10
Jann_1048 Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is a regulatory subunit Jann:1.003..1.004 Mbp (891 bp) score=10
Jann_1049 Produces ATP from ADP in the presence of a proton gradient across the membrane. The beta chain is a regulatory subunit Jann:1.004..1.005 Mbp (1.425 kbp) score=10
Jann_1219 negative regulator of AmpC, AmpD Jann:1.179..1.179 Mbp (684 bp) score=10
Jann_1455 regulatory protein, LacI Jann:1.425..1.426 Mbp (1.071 kbp) score=10
Jann_1469 response regulator receiver domain-containing protein Jann:1.439..1.44 Mbp (1.014 kbp) score=10
Jann_1516 nitrogen regulatory protein P-II Jann:1.486..1.486 Mbp (339 bp) score=10
Jann_1533 response regulator receiver domain-containing protein Jann:1.504..1.505 Mbp (450 bp) score=10
Jann_1534 response regulator receiver domain-containing protein Jann:1.505..1.506 Mbp (1.161 kbp) score=10
Jann_1652 ferric uptake regulator family protein Jann:1.637..1.638 Mbp (525 bp) score=10
ihfA This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control Jann:1.772..1.772 Mbp (303 bp) score=10
Jann_1799 FUR family manganese uptake regulator Jann:1.789..1.789 Mbp (414 bp) score=10
ilvH acetolactate synthase 3 regulatory subunit Jann:1.881..1.882 Mbp (558 bp) score=10
Jann_2069 response regulator receiver domain-containing protein Jann:2.079..2.079 Mbp (372 bp) score=10
Jann_2293 phosphate uptake regulator PhoU Jann:2.3..2.301 Mbp (711 bp) score=10
Jann_2476 Catalyzes a key regulatory step in fatty acid biosynthesis Jann:2.473..2.474 Mbp (813 bp) score=10
Jann_2695 response regulator receiver domain-containing protein Jann:2.706..2.707 Mbp (561 bp) score=10
Jann_2838 response regulator receiver domain-containing protein Jann:2.856..2.856 Mbp (387 bp) score=10
Jann_2842 response regulator receiver domain-containing protein Jann:2.86..2.86 Mbp (381 bp) score=10
Jann_3038 response regulator receiver/ANTAR domain-containing protein Jann:3.064..3.065 Mbp (621 bp) score=10
Jann_3131 response regulator receiver modulated diguanylate cyclase Jann:3.172..3.174 Mbp (1.395 kbp) score=10
Jann_3165 response regulator receiver domain-containing protein Jann:3.204..3.205 Mbp (708 bp) score=10
Jann_3566 two-component response regulator Jann:3.631..3.632 Mbp (828 bp) score=10
ihfB This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control Jann:3.664..3.665 Mbp (288 bp) score=10
Jann_3936 LacI family transcription regulator Jann:4.034..4.035 Mbp (1.074 kbp) score=10
Jann_4052 putative anti-sigma regulatory factor Jann:4.156..4.156 Mbp (513 bp) score=10
Jann_4056 nitrogen regulatory protein P-II Jann:4.161..4.162 Mbp (339 bp) score=10
Jann_4068 response regulator receiver domain-containing protein Jann:4.177..4.177 Mbp (561 bp) score=10
flbT post-transcriptional repressor of flagellum biosynthesis; promotes degradation of fljK mRNA: Bradyrhizobium has one thick flagellum and several thin flagella; the protein in this cluster is associated with the thin flagella Jann:4.307..4.307 Mbp (405 bp) score=10
flaF flagellar biosynthesis regulatory protein FlaF Jann:4.307..4.308 Mbp (375 bp) score=10
- Tracks
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70