Roseobase:Jannaschia sp. CCS1

Showing 100 kbp from Jann, positions 1 to 100,000

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: Jann:48..1475, Jann_4283, recF, YP_512158, Jann_R0021, Jann_R0043, transcriptional regulator, IAHTLMADRFGLDIGAGLEQPIDIQKGDIFLRLDLDPECPMPALTEIQRMRRHGVKVFNV.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
 Scroll/Zoom:     
- Overview
__scale__ overview
- Details
__scale__ detail
Definition lineORIGIN detail
Annotated GenesGENE detail
Coding RegionsCDS detail
tRNAstRNA detail
rRNAsrRNA detail
tmRNAstmRNA detail
misc_RNAsmisc_RNA detail
DNA/GC ContentDNA/GC Content detail
Clear highlighting
- Tracks
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
Upload your own data: [Help]
Upload a file    
Add remote annotations: [Help]
Enter Remote Annotation URL  
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70