Roseobase: Sulfitobacter sp. EE36

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: EE36:300000..400000, EE36_15487, ribH, ZP_00956658, translation initiation factor, SGLPRDAYARARINRSGRRYASVHVEAWQDNRSKLFAQATGHFLMPQRRD.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 72 regions match your request.
Matches on EE36
overview_EE36
EE36_03183 COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) elongation factor P EE36:472.9..473.4 kbp (525 bp) score=60
infB COG0532 Translation initiation factor 2 (IF-2; GTPase) translation initiation factor IF-2 EE36:1.336..1.339 Mbp (2.484 kbp) score=60
EE36_10055 COG0361 Translation initiation factor 1 (IF-1) translation initiation factor IF-1 EE36:1.849..1.849 Mbp (219 bp) score=60
EE36_13668 COG0290 Translation initiation factor 3 (IF-3) translation initiation factor EE36:2.589..2.589 Mbp (606 bp) score=60
EE36_03028 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB EE36:438.3..438.7 kbp (405 bp) score=40
EE36_04698 COG0050 GTPases - translation elongation factors translation elongation factor Tu EE36:745.1..746.3 kbp (1.176 kbp) score=40
EE36_04703 COG0480 Translation elongation factors (GTPases) translation elongation factor G EE36:746.4..748.5 kbp (2.127 kbp) score=40
EE36_04783 COG0050 GTPases - translation elongation factors translation elongation factor Tu EE36:764.6..765.8 kbp (1.176 kbp) score=40
EE36_09210 COG3276 Selenocysteine-specific translation elongation factor Translation elongation factor, selenocysteine-specific EE36:1.684..1.686 Mbp (1.872 kbp) score=40
EE36_06008 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) anti-anti-sigma factor EE36:1.019..1.019 Mbp (294 bp) score=30
EE36_07228 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) EE36:1.272..1.273 Mbp (693 bp) score=30
tsf COG0264 Translation elongation factor Ts elongation factor Ts EE36:2.924..2.925 Mbp (876 bp) score=30
EE36_00425 COG0251 Putative translation initiation inhibitor, yjgF family protein EE36:89.34..89.65 kbp (312 bp) score=20
EE36_02898 COG0781 Transcription termination factor transcription antitermination factor NusB EE36:414..414.4 kbp (480 bp) score=20
EE36_04113 COG0782 Transcription elongation factor transcription elongation factor GreA EE36:647.2..647.7 kbp (471 bp) score=20
EE36_04178 COG0009 Putative translation factor (SUA5) EE36:658.2..659.1 kbp (945 bp) score=20
EE36_04288 COG0314 Molybdopterin converting factor, large subunit molybdopterin converting factor, subunit 2 EE36:678.6..679 kbp (444 bp) score=20
EE36_04293 COG1977 Molybdopterin converting factor, small subunit putative molybdopterin MPT converting factor, subunit 1 protein EE36:679..679.2 kbp (246 bp) score=20
dnaA COG0593 ATPase involved in DNA replication initiation chromosomal replication initiation protein EE36:903.1..904.4 kbp (1.359 kbp) score=20
EE36_05828 COG0858 Ribosome-binding factor A ribosome-binding factor A EE36:979.8..980.2 kbp (429 bp) score=20
EE36_06013 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) anti-sigma B factor, putative EE36:1.019..1.019 Mbp (480 bp) score=20
rho COG1158 Transcription termination factor transcription termination factor Rho EE36:1.291..1.292 Mbp (1.272 kbp) score=20
EE36_07538 COG0195 Transcription elongation factor transcription elongation factor NusA EE36:1.334..1.336 Mbp (1.629 kbp) score=20
EE36_08293 COG0251 Putative translation initiation inhibitor, yjgF family protein EE36:1.504..1.504 Mbp (469 bp) score=20
EE36_08783 COG0728 Uncharacterized membrane protein, putative virulence factor putative virulence factor, MviN EE36:1.593..1.594 Mbp (1.593 kbp) score=20
EE36_09615 COG0012 Predicted GTPase, probable translation factor EE36:1.76..1.761 Mbp (1.098 kbp) score=20
EE36_10999 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family protein xanthine dehydrogenase accessory factor EE36:2.039..2.04 Mbp (972 bp) score=20
EE36_13073 COG0251 Putative translation initiation inhibitor, yjgF family protein EE36:2.47..2.47 Mbp (360 bp) score=20
EE36_13283 COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) trigger factor EE36:2.514..2.516 Mbp (1.332 kbp) score=20
EE36_14467 COG1186 Protein chain release factor B peptide chain release factor 2 EE36:2.742..2.743 Mbp (1.125 kbp) score=20
EE36_14757 COG0233 Ribosome recycling factor ribosome recycling factor EE36:2.808..2.809 Mbp (564 bp) score=20
EE36_15082 COG1197 Transcription-repair coupling factor (superfamily protein II helicase) transcription-repair coupling factor EE36:2.873..2.877 Mbp (3.489 kbp) score=20
EE36_15137 COG0216 Protein chain release factor A peptide chain release factor 1 EE36:2.884..2.885 Mbp (1.056 kbp) score=20
EE36_16192 COG0315 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein C EE36:3.098..3.098 Mbp (474 bp) score=20
EE36_16437 COG4108 Peptide chain release factor RF-3 peptide chain release factor 3 EE36:3.149..3.15 Mbp (1.62 kbp) score=20
EE36_16672 COG2896 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein A EE36:3.194..3.195 Mbp (1.008 kbp) score=20
EE36_00725 COG3806 Anti-sigma factor EE36:150..150.3 kbp (306 bp) score=10
EE36_01530 hemin degrading factor EE36:298..299 kbp (1.056 kbp) score=10
EE36_01910 COG0593 ATPase involved in DNA replication initiation EE36:379..379.7 kbp (696 bp) score=10
EE36_02863 RNA polymerase sigma factor EE36:408..408.9 kbp (897 bp) score=10
EE36_02968 RNA polymerase sigma factor EE36:426.1..428.1 kbp (1.983 kbp) score=10
EE36_03008 RNA polymerase sigma-70 factor EE36:435.9..436.4 kbp (510 bp) score=10
EE36_03018 RNA polymerase sigma-70 factor, ECF family protein EE36:436.7..437.4 kbp (687 bp) score=10
EE36_03413 integration host factor beta subunit EE36:513.5..513.8 kbp (285 bp) score=10
EE36_04203 molybdenum cofactor biosynthesis protein B EE36:665.7..666.2 kbp (543 bp) score=10
EE36_04768 transcription termination/antitermination factor NusG EE36:763.3..763.8 kbp (534 bp) score=10
EE36_06473 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain protein) EE36:1.109..1.11 Mbp (885 bp) score=10
EE36_06533 COG1186 Protein chain release factor B EE36:1.125..1.126 Mbp (423 bp) score=10
EE36_06948 RNA polymerase sigma-70 factor EE36:1.213..1.213 Mbp (558 bp) score=10
EE36_07278 COG0195 Transcription elongation factor EE36:1.285..1.286 Mbp (660 bp) score=10
EE36_08118 COG1197 Transcription-repair coupling factor (superfamily protein II helicase) EE36:1.476..1.477 Mbp (357 bp) score=10
EE36_08348 molybdenum cofactor biosynthesis domain protein EE36:1.512..1.513 Mbp (720 bp) score=10
EE36_08533 nuclear receptor binding factor related protein EE36:1.549..1.55 Mbp (981 bp) score=10
EE36_08828 RNA polymerase sigma factor EE36:1.604..1.605 Mbp (888 bp) score=10
EE36_09635 RNA polymerase sigma-70 factor EE36:1.765..1.766 Mbp (543 bp) score=10
EE36_09680 COG1198 Primosomal protein N' (replication factor Y) - superfamily protein II helicase EE36:1.774..1.776 Mbp (2.151 kbp) score=10
EE36_09910 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) EE36:1.821..1.822 Mbp (936 bp) score=10
EE36_09920 COG3175 Cytochrome oxidase assembly factor EE36:1.822..1.823 Mbp (576 bp) score=10
EE36_11853 COG0593 ATPase involved in DNA replication initiation EE36:2.231..2.231 Mbp (684 bp) score=10
EE36_12528 COG4235 Cytochrome c biogenesis factor EE36:2.361..2.362 Mbp (1.227 kbp) score=10
tig trigger factor EE36:2.513..2.513 Mbp (279 bp) score=10
EE36_13638 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family protein EE36:2.581..2.581 Mbp (969 bp) score=10
EE36_14302 iron-sulfur cluster assembly transcription factor IscR, putative EE36:2.706..2.707 Mbp (471 bp) score=10
EE36_14862 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation EE36:2.829..2.83 Mbp (1.353 kbp) score=10
EE36_15037 COG1923 Uncharacterized host factor I protein EE36:2.864..2.865 Mbp (240 bp) score=10
EE36_15142 COG2890 Methylase of polypeptide chain release factors EE36:2.885..2.886 Mbp (843 bp) score=10
EE36_15972 integration host factor, alpha subunit EE36:3.05..3.05 Mbp (303 bp) score=10
EE36_16197 molybdenum cofactor biosynthesis protein A EE36:3.098..3.099 Mbp (1.173 kbp) score=10
EE36_16242 COG1138 Cytochrome c biogenesis factor EE36:3.107..3.109 Mbp (1.962 kbp) score=10
EE36_16292 COG3552 Protein containing von Willebrand factor type A (vWA) domain protein EE36:3.121..3.122 Mbp (1.263 kbp) score=10
EE36_16457 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor EE36:3.155..3.156 Mbp (774 bp) score=10
EE36_16962 COG3806 Anti-sigma factor EE36:3.258..3.259 Mbp (681 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70