Roseobase: Celeribacter baekdonensis B30

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: B30:500000..600000, B30_00005, mepA, ZP_11131551, B30_t20113, rRNA, signal peptidase, TEGVEAILAALDEQDAQYKGPPRKIALAINKIDMVPVEKLLDMTKVLNERRN.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 93 regions match your request.
Matches on B30
overview_B30
B30_00095 signal peptidase I COG0681 Signal peptidase I B30:15.4..16.17 kbp (777 bp) score=40
B30_03400 lipoprotein signal peptidase COG0597 Lipoprotein signal peptidase B30:703.6..704.1 kbp (474 bp) score=40
B30_17882 lipoprotein signal peptidase COG0597 Lipoprotein signal peptidase B30:3.681..3.681 Mbp (459 bp) score=40
B30_10190 dipeptidase COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog B30:2.093..2.094 Mbp (969 bp) score=30
B30_13759 membrane dipeptidase COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog B30:2.846..2.847 Mbp (1.179 kbp) score=30
B30_16213 leucyl aminopeptidase COG2309 Leucyl aminopeptidase (aminopeptidase T) B30:3.332..3.333 Mbp (1.032 kbp) score=30
B30_17605 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase COG2027 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) B30:3.62..3.621 Mbp (1.485 kbp) score=30
B30_00465 methionine aminopeptidase COG0024 Methionine aminopeptidase B30:84.07..84.92 kbp (849 bp) score=20
B30_00580 leucyl aminopeptidase COG0260 Leucyl aminopeptidase B30:105.2..106.6 kbp (1.383 kbp) score=20
mepA penicillin-insensitive murein endopeptidase COG3770 Murein endopeptidase B30:184..184.9 kbp (909 bp) score=20
B30_03410 peptidase M16 domain-containing protein COG0612 Predicted Zn-dependent peptidases; overlaps another CDS with the same product name B30:704.8..706.2 kbp (1.347 kbp) score=20
B30_03415 peptidase M16 domain-containing protein COG0612 Predicted Zn-dependent peptidases; overlaps another CDS with the same product name B30:706.2..707.5 kbp (1.308 kbp) score=20
B30_04002 aminopeptidase P COG0006 Xaa-Pro aminopeptidase B30:836..837.8 kbp (1.794 kbp) score=20
B30_04497 peptidase M23B COG0739 Membrane proteins related to metalloendopeptidases B30:937.5..938.7 kbp (1.197 kbp) score=20
B30_04732 peptidase M20D, amidohydrolase COG1473 Metal-dependent amidase/aminoacylase/carboxypeptidase B30:982.3..983.4 kbp (1.164 kbp) score=20
pepN aminopeptidase N COG0308 Aminopeptidase N B30:999.2 kbp..1.002 Mbp (2.61 kbp) score=20
B30_05352 alkaline D-peptidase and alkaline D-peptidase fusion B30:1.104..1.105 Mbp (1.146 kbp) score=20
B30_05732 methionine aminopeptidase COG0024 Methionine aminopeptidase B30:1.181..1.182 Mbp (765 bp) score=20
B30_05767 M16 family peptidase COG0612 Predicted Zn-dependent peptidases B30:1.187..1.189 Mbp (1.26 kbp) score=20
B30_07356 D-alanyl-D-alanine carboxypeptidase COG1686 D-alanyl-D-alanine carboxypeptidase B30:1.514..1.516 Mbp (1.206 kbp) score=20
B30_07641 M24/M37 family peptidase COG0739 Membrane proteins related to metalloendopeptidases B30:1.574..1.575 Mbp (1.305 kbp) score=20
B30_09258 multifunctional aminopeptidase A COG0260 Leucyl aminopeptidase B30:1.905..1.906 Mbp (1.467 kbp) score=20
B30_09468 thermostable carboxypeptidase COG2317 Zn-dependent carboxypeptidase B30:1.945..1.947 Mbp (1.482 kbp) score=20
B30_10380 peptidase, M24 family protein COG0006 Xaa-Pro aminopeptidase B30:2.129..2.13 Mbp (1.185 kbp) score=20
B30_11365 peptidase S1 and S6, chymotrypsin/Hap COG3591 V8-like Glu-specific endopeptidase B30:2.321..2.321 Mbp (801 bp) score=20
B30_12392 D-alanyl-D-alanine carboxypeptidase COG1686 D-alanyl-D-alanine carboxypeptidase B30:2.528..2.529 Mbp (1.566 kbp) score=20
B30_13749 oligoendopeptidase F COG1164 Oligoendopeptidase F B30:2.843..2.845 Mbp (1.833 kbp) score=20
B30_14946 M23 family peptidase COG0739 Membrane proteins related to metalloendopeptidases B30:3.078..3.079 Mbp (972 bp) score=20
B30_16733 peptidyl-dipeptidase Dcp COG0339 Zn-dependent oligopeptidases B30:3.433..3.435 Mbp (2.022 kbp) score=20
B30_17897 peptidase family M23 COG0739 Membrane proteins related to metalloendopeptidases B30:3.682..3.684 Mbp (1.374 kbp) score=20
B30_18987 putative regulator of cell morphogenesis and NO signaling COG2846 Regulator of cell morphogenesis and NO signaling B30:3.904..3.905 Mbp (486 bp) score=20
B30_00050 two component signal transduction response regulator receiver protein ChvI B30:6.836..7.537 kbp (702 bp) score=10
B30_00390 COG0744 Membrane carboxypeptidase (penicillin-binding protein) B30:69.18..71.39 kbp (2.214 kbp) score=10
B30_00730 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:141.7..142.5 kbp (834 bp) score=10
B30_01050 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:204.8..205.8 kbp (1.053 kbp) score=10
B30_01095 COG4942 Membrane-bound metallopeptidase B30:215.1..216.2 kbp (1.134 kbp) score=10
B30_01255 serine peptidase B30:249.6..252.2 kbp (2.634 kbp) score=10
B30_01350 twin-arginine translocation pathway signal domain-containing protein B30:276.7..277.4 kbp (660 bp) score=10
B30_02010 COG0744 Membrane carboxypeptidase (penicillin-binding protein) B30:420.4..421.2 kbp (729 bp) score=10
B30_02195 proline iminopeptidase B30:463.6..464.6 kbp (978 bp) score=10
B30_02435 COG5405 ATP-dependent protease HslVU (ClpYQ), peptidase subunit B30:507.8..508.3 kbp (558 bp) score=10
B30_02710 chemotactic signal-response protein B30:570.7..571 kbp (291 bp) score=10
B30_03170 microcin-processing peptidase 1 B30:657.6..659 kbp (1.347 kbp) score=10
B30_03255 peptidase S16, lon-like protein B30:675.7..676.4 kbp (636 bp) score=10
B30_04172 PfpI family intracellular peptidase B30:876.9..877.5 kbp (558 bp) score=10
B30_04952 signal recognition particle-docking protein FtsY B30:1.03..1.031 Mbp (1.209 kbp) score=10
B30_05107 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:1.061..1.061 Mbp (720 bp) score=10
B30_06016 twin-arginine translocation pathway signal sequence domain-containing protein B30:1.24..1.24 Mbp (558 bp) score=10
B30_06156 peptidase M48 Ste24p B30:1.27..1.272 Mbp (1.149 kbp) score=10
B30_06166 COG1473 Metal-dependent amidase/aminoacylase/carboxypeptidase B30:1.273..1.274 Mbp (1.167 kbp) score=10
B30_06731 signal transduction histidine kinase B30:1.379..1.381 Mbp (2.295 kbp) score=10
B30_06806 COG0835 Chemotaxis signal transduction protein B30:1.399..1.4 Mbp (468 bp) score=10
B30_07716 sensor signal transduction histidine kinase B30:1.589..1.591 Mbp (1.815 kbp) score=10
B30_07741 COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) B30:1.595..1.596 Mbp (714 bp) score=10
B30_07896 signal-transduction protein B30:1.626..1.627 Mbp (435 bp) score=10
B30_08168 proline-specific peptidase B30:1.674..1.675 Mbp (921 bp) score=10
B30_08398 twin-arginine translocation pathway signal B30:1.722..1.724 Mbp (1.881 kbp) score=10
B30_08433 integral membrane sensor signal transduction histidine kinase B30:1.729..1.73 Mbp (1.425 kbp) score=10
B30_08438 twin-arginine translocation pathway signal B30:1.731..1.732 Mbp (1.095 kbp) score=10
B30_08518 peptidase M48, Ste24p B30:1.749..1.75 Mbp (684 bp) score=10
B30_08708 peptidase M48 Ste24p B30:1.785..1.786 Mbp (1.338 kbp) score=10
B30_08738 COG5009 Membrane carboxypeptidase/penicillin-binding protein B30:1.791..1.794 Mbp (2.505 kbp) score=10
B30_09703 peptidase M50 family protein B30:1.991..1.992 Mbp (1.338 kbp) score=10
B30_09838 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:2.019..2.02 Mbp (828 bp) score=10
B30_10260 twin-arginine translocation pathway signal B30:2.105..2.106 Mbp (1.113 kbp) score=10
B30_10375 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:2.128..2.129 Mbp (843 bp) score=10
B30_10395 COG0739 Membrane proteins related to metalloendopeptidases B30:2.132..2.133 Mbp (975 bp) score=10
B30_10965 COG1473 Metal-dependent amidase/aminoacylase/carboxypeptidase B30:2.244..2.245 Mbp (1.167 kbp) score=10
B30_11170 signal recognition particle protein B30:2.282..2.284 Mbp (1.524 kbp) score=10
B30_11662 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:2.38..2.382 Mbp (1.035 kbp) score=10
B30_11742 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:2.4..2.4 Mbp (786 bp) score=10
B30_11872 peptidase S49 B30:2.426..2.427 Mbp (795 bp) score=10
B30_12652 COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain B30:2.596..2.599 Mbp (2.595 kbp) score=10
B30_12682 COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains B30:2.604..2.605 Mbp (1.818 kbp) score=10
B30_13089 twin-arginine translocation pathway signal B30:2.697..2.698 Mbp (525 bp) score=10
B30_13199 periplasmic sensor signal transduction histidine kinase B30:2.723..2.725 Mbp (1.812 kbp) score=10
B30_14089 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:2.907..2.908 Mbp (912 bp) score=10
B30_14599 peptidase M22 glycoprotease B30:3.002..3.002 Mbp (609 bp) score=10
B30_14609 O-sialoglycoprotein endopeptidase B30:3.003..3.004 Mbp (993 bp) score=10
B30_15221 M48 family peptidase B30:3.13..3.131 Mbp (708 bp) score=10
B30_15781 peptidase A24A prepilin type IV B30:3.242..3.242 Mbp (492 bp) score=10
B30_15868 COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain B30:3.26..3.262 Mbp (2.136 kbp) score=10
B30_16103 peptidase U32 B30:3.311..3.312 Mbp (999 bp) score=10
B30_16113 COG2846 Regulator of cell morphogenesis and NO signaling B30:3.313..3.314 Mbp (555 bp) score=10
B30_16308 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:3.351..3.351 Mbp (852 bp) score=10
B30_17063 periplasmic sensor signal transduction histidine kinase B30:3.5..3.501 Mbp (1.344 kbp) score=10
B30_17195 twin-arginine translocation pathway signal B30:3.525..3.526 Mbp (1.353 kbp) score=10
B30_18007 integral membrane sensor signal transduction histidine kinase B30:3.699..3.701 Mbp (1.386 kbp) score=10
B30_19243 C factor, cell signaling protein B30:3.953..3.954 Mbp (663 bp) score=10
B30_19906 COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain B30:4.076..4.077 Mbp (1.026 kbp) score=10
B30_20026 COG5001 Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain B30:4.099..4.1 Mbp (1.545 kbp) score=10
B30_20563 COG2856 Predicted Zn peptidase B30:4.2..4.201 Mbp (789 bp) score=10
B30_20900 COG2856 Predicted Zn peptidase B30:4.274..4.275 Mbp (1.209 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70