Roseobacter denitrificans OCh 114

Showing 1.893 kbp from RD1, positions 1,601,464 to 1,603,356

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RD1:4326593..4327180, RD1_0005, RD1_A0005, RD1_B0056, RD1_C0016, RD1_D0006, dmdA, transcriptional regulator, KGQAAQLEALALRAERHLSEWHVPDAGHQDRIDRLLRDWAAARAEGRFEQGALVKMGA.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
Scroll/Zoom:     
- Overview
__scale__ overview
- Details
__scale__ detail
Definition lineORIGIN detail
Annotated GenesGENE detail
Coding RegionsCDS detail
tRNAstRNA detail
rRNAsrRNA detail
Pseudogenespseudogene detail
PseudotRNAspseudotRNA detail
mics_RNAsmisc_RNA detail
DNA/GC ContentDNA/GC Content detail
Clear highlighting

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70