Roseobacter denitrificans OCh 114

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RD1:4326593..4327180, RD1_0005, RD1_A0005, RD1_B0056, RD1_C0016, RD1_D0006, dmdA, transcriptional regulator, KGQAAQLEALALRAERHLSEWHVPDAGHQDRIDRLLRDWAAARAEGRFEQGALVKMGA.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 190 regions match your request.
Matches on RD1
overview_RD1
araC AraC family transcriptional regulator RD1:6.341..7.435 kbp (1.095 kbp) score=20
araC AraC family transcriptional regulator RD1:6.341..7.435 kbp (1.095 kbp) score=20
ppsR transcriptional regulator PpsR RD1:143..144.4 kbp (1.428 kbp) score=20
RD1_0171 transcriptional regulator RD1:169.8..170.4 kbp (660 bp) score=20
RD1_0234 LacI family transcriptional regulator RD1:233.6..234.8 kbp (1.158 kbp) score=20
RD1_0249 AraC family transcriptional regulator RD1:249.2..250.3 kbp (1.146 kbp) score=20
RD1_0318 TetR family transcriptional regulator RD1:306.5..307.2 kbp (618 bp) score=20
RD1_0393 MarR family transcriptional regulator RD1:387..387.5 kbp (444 bp) score=20
RD1_0490 LacI family transcriptional regulator RD1:476.7..477.7 kbp (999 bp) score=20
RD1_0515 TetR family transcriptional regulator RD1:501.4..502 kbp (672 bp) score=20
marR MarR family transcriptional regulator RD1:536.2..536.7 kbp (513 bp) score=20
RD1_0561 transcriptional regulator RD1:544.6..545.2 kbp (627 bp) score=20
RD1_0682 transcriptional regulatory protein RD1:662.8..663.4 kbp (678 bp) score=20
RD1_0743 transcriptional regulator RD1:716.8..717.5 kbp (657 bp) score=20
tenA transcriptional regulator RD1:726.8..727.4 kbp (654 bp) score=20
tenA transcriptional regulator RD1:726.8..727.4 kbp (654 bp) score=20
RD1_0816 Crp/FNR family transcriptional regulator RD1:798.5..799.2 kbp (618 bp) score=20
RD1_0820 LysR family transcriptional regulator RD1:802.4..803.4 kbp (978 bp) score=20
RD1_0834 transcriptional regulator RD1:813.6..815.1 kbp (1.464 kbp) score=20
RD1_0838 transcriptional regulator RD1:816.2..816.8 kbp (579 bp) score=20
RD1_0853 GntR family transcriptional regulator RD1:830.4..831.1 kbp (720 bp) score=20
RD1_0879 LuxR family transcriptional regulator RD1:855.1..855.9 kbp (720 bp) score=20
zntR HTH-type transcriptional regulator ZntR RD1:889.2..889.7 kbp (438 bp) score=20
RD1_0955 LysR family transcriptional regulator RD1:922.4..923.3 kbp (909 bp) score=20
RD1_0978 GntR family transcriptional regulator RD1:943.3..944.8 kbp (1.482 kbp) score=20
RD1_0992 ArsR family transcriptional regulator RD1:957.8..958.1 kbp (315 bp) score=20
RD1_0997 transcriptional regulator RD1:960.8..961.5 kbp (645 bp) score=20
RD1_1000 AsnC family transcriptional regulator RD1:963.2..963.7 kbp (453 bp) score=20
RD1_1034 AsnC family transcriptional regulator RD1:1.001..1.002 Mbp (465 bp) score=20
RD1_1053 GntR family transcriptional regulator RD1:1.015..1.015 Mbp (726 bp) score=20
RD1_1134 LysR family transcriptional regulator RD1:1.097..1.098 Mbp (891 bp) score=20
RD1_1135 HTH-type transcriptional regulator acrR RD1:1.098..1.098 Mbp (597 bp) score=20
prrA transcriptional regulatory protein PrrA RD1:1.116..1.116 Mbp (687 bp) score=20
RD1_1169 LysR family transcriptional regulator RD1:1.133..1.133 Mbp (915 bp) score=20
RD1_1317 LysR family transcriptional regulator RD1:1.271..1.272 Mbp (879 bp) score=20
RD1_1319 ArsR family transcriptional regulator RD1:1.273..1.273 Mbp (573 bp) score=20
RD1_1343 TetR family transcriptional regulator RD1:1.294..1.295 Mbp (693 bp) score=20
RD1_1371 transcriptional regulatory protein RD1:1.317..1.317 Mbp (522 bp) score=20
RD1_1373 HTH-type transcriptional regulator RD1:1.319..1.32 Mbp (360 bp) score=20
RD1_1374 transcriptional regulator RD1:1.32..1.321 Mbp (924 bp) score=20
RD1_1479 GntR family transcriptional regulator RD1:1.404..1.405 Mbp (648 bp) score=20
RD1_1487 LacI family transcriptional regulator RD1:1.411..1.412 Mbp (1.032 kbp) score=20
RD1_1498 RpiR family transcriptional regulator RD1:1.424..1.425 Mbp (858 bp) score=20
RD1_1507 ArsR family transcriptional regulator RD1:1.432..1.433 Mbp (417 bp) score=20
rrf transcriptional regulator RD1:1.624..1.625 Mbp (444 bp) score=20
RD1_1700 AraC family transcriptional regulator RD1:1.634..1.635 Mbp (1.002 kbp) score=20
RD1_1727 GntR family transcriptional regulator RD1:1.658..1.659 Mbp (765 bp) score=20
metR HTH-type transcriptional regulator metR RD1:1.691..1.692 Mbp (906 bp) score=20
nrdR transcriptional regulator NrdR RD1:1.728..1.729 Mbp (468 bp) score=20
RD1_1811 AraC family transcriptional regulator RD1:1.735..1.736 Mbp (1.014 kbp) score=20
RD1_1825 CarD family transcriptional regulator RD1:1.75..1.751 Mbp (513 bp) score=20
RD1_1829 AsnC family transcriptional regulator RD1:1.754..1.755 Mbp (456 bp) score=20
RD1_1837 LysR family transcriptional regulator RD1:1.762..1.763 Mbp (891 bp) score=20
RD1_1855 rrf2 family transcriptional regulator RD1:1.777..1.777 Mbp (534 bp) score=20
mucS MarR family transcriptional regulator RD1:1.79..1.791 Mbp (513 bp) score=20
RD1_1955 AsnC family transcriptional regulator RD1:1.868..1.869 Mbp (456 bp) score=20
RD1_1956 AsnC family transcriptional regulator RD1:1.869..1.869 Mbp (456 bp) score=20
RD1_1961 GntR family transcriptional regulator RD1:1.873..1.874 Mbp (696 bp) score=20
RD1_2004 LysR family transcriptional regulator RD1:1.912..1.912 Mbp (876 bp) score=20
phrR Cro/CI family transcriptional regulator RD1:1.913..1.913 Mbp (378 bp) score=20
betI transcriptional regulator BetI RD1:1.928..1.928 Mbp (576 bp) score=20
RD1_2203 transcriptional regulator RD1:2.102..2.103 Mbp (1.407 kbp) score=20
RD1_2208 TetR family transcriptional regulator RD1:2.11..2.111 Mbp (621 bp) score=20
frcR ROK family transcriptional regulator RD1:2.115..2.117 Mbp (1.209 kbp) score=20
dctD C4-dicarboxylate transport transcriptional regulatory protein DctD RD1:2.166..2.168 Mbp (1.335 kbp) score=20
RD1_2283 GntR family transcriptional regulator RD1:2.179..2.18 Mbp (759 bp) score=20
hmrR HTH-type transcriptional regulator hmrR RD1:2.201..2.202 Mbp (402 bp) score=20
RD1_2309 transcriptional regulator RD1:2.205..2.206 Mbp (678 bp) score=20
RD1_2320 transcriptional regulator RD1:2.215..2.216 Mbp (1.029 kbp) score=20
RD1_2356 TetR family transcriptional regulator RD1:2.253..2.253 Mbp (597 bp) score=20
RD1_2359 MarR family transcriptional regulator RD1:2.256..2.256 Mbp (492 bp) score=20
RD1_2370 LysR family transcriptional regulator RD1:2.263..2.264 Mbp (894 bp) score=20
RD1_2379 IclR family transcriptional regulator RD1:2.268..2.269 Mbp (825 bp) score=20
RD1_2385 transcriptional regulator RD1:2.276..2.277 Mbp (1.011 kbp) score=20
phnF phosphonates metabolism transcriptional regulator PhnF RD1:2.284..2.284 Mbp (669 bp) score=20
RD1_2411 GntR family transcriptional regulator RD1:2.301..2.301 Mbp (705 bp) score=20
RD1_2417 DeoR family transcriptional regulator RD1:2.306..2.307 Mbp (774 bp) score=20
RD1_2433 transcriptional regulator RD1:2.32..2.32 Mbp (231 bp) score=20
RD1_2496 transcriptional regulator RD1:2.383..2.383 Mbp (570 bp) score=20
RD1_2500 LysR family transcriptional regulator RD1:2.386..2.386 Mbp (897 bp) score=20
pobR AraC family transcriptional regulator RD1:2.468..2.469 Mbp (804 bp) score=20
ctrA transcriptional regulator CtrA RD1:2.484..2.484 Mbp (720 bp) score=20
RD1_2634 AraC family transcriptional regulator RD1:2.514..2.515 Mbp (945 bp) score=20
phoB phosphate regulon transcriptional regulatory protein PhoB RD1:2.528..2.528 Mbp (690 bp) score=20
RD1_2700 transcriptional regulator RD1:2.571..2.572 Mbp (474 bp) score=20
RD1_2742 transcriptional regulator RD1:2.612..2.613 Mbp (624 bp) score=20
RD1_2787 TetR family transcriptional regulator RD1:2.657..2.658 Mbp (657 bp) score=20
RD1_2842 transcriptional regulator RD1:2.712..2.713 Mbp (1.29 kbp) score=20
RD1_2861 IclR family transcriptional regulator RD1:2.73..2.731 Mbp (792 bp) score=20
RD1_2894 transcriptional regulator RD1:2.773..2.774 Mbp (672 bp) score=20
RD1_2923 LacI family transcriptional regulator RD1:2.799..2.8 Mbp (1.038 kbp) score=20
RD1_2988 LysR family transcriptional regulator RD1:2.863..2.864 Mbp (897 bp) score=20
RD1_3082 DeoR family transcriptional regulator RD1:2.953..2.954 Mbp (813 bp) score=20
fixJ transcriptional regulatory protein FixJ RD1:2.96..2.961 Mbp (642 bp) score=20
RD1_3102 TetR family transcriptional regulator RD1:2.979..2.98 Mbp (609 bp) score=20
RD1_3231 LysR family transcriptional regulator RD1:3.099..3.1 Mbp (906 bp) score=20
RD1_3257 transcriptional regulator RD1:3.123..3.123 Mbp (666 bp) score=20
RD1_3397 DNA-binding transcriptional activator GcvA Glycine cleavage system transcriptional activator; activates the gcvTHP operon in the presence of glycine and represses the operon in its absence RD1:3.263..3.264 Mbp (933 bp) score=20
arsR ArsR family transcriptional regulator RD1:3.355..3.355 Mbp (315 bp) score=20
RD1_3504 AsnC family transcriptional regulator RD1:3.369..3.37 Mbp (498 bp) score=20
deoR DeoR family transcriptional regulator RD1:3.434..3.435 Mbp (780 bp) score=20
RD1_3583 AraC family transcriptional regulator RD1:3.445..3.446 Mbp (963 bp) score=20
RD1_3649 transcriptional regulator RD1:3.513..3.514 Mbp (789 bp) score=20
RD1_3650 MarR family transcriptional regulator RD1:3.514..3.514 Mbp (549 bp) score=20
RD1_3673 TetR family transcriptional regulator RD1:3.537..3.538 Mbp (597 bp) score=20
RD1_3722 LacI family transcriptional regulator RD1:3.593..3.594 Mbp (1.041 kbp) score=20
RD1_3751 transcriptional regulator RD1:3.637..3.637 Mbp (606 bp) score=20
RD1_3759 LysR family transcriptional regulator RD1:3.641..3.642 Mbp (897 bp) score=20
RD1_3782 AraC family transcriptional regulator RD1:3.662..3.663 Mbp (1.008 kbp) score=20
gntR GntR family transcriptional regulator RD1:3.667..3.668 Mbp (696 bp) score=20
gntR GntR family transcriptional regulator RD1:3.667..3.668 Mbp (696 bp) score=20
RD1_3807 LacI family transcriptional regulator RD1:3.68..3.681 Mbp (1.023 kbp) score=20
lysR LysR family transcriptional regulator RD1:3.738..3.739 Mbp (1.098 kbp) score=20
RD1_3869 AraC family transcriptional regulator RD1:3.74..3.741 Mbp (1.032 kbp) score=20
RD1_3887 transcriptional regulator protein RD1:3.756..3.757 Mbp (1.023 kbp) score=20
RD1_3922 FUR family transcriptional regulator RD1:3.787..3.788 Mbp (420 bp) score=20
RD1_3944 LacI family transcriptional regulator RD1:3.805..3.806 Mbp (1.017 kbp) score=20
RD1_3957 LysR family transcriptional regulator RD1:3.816..3.817 Mbp (888 bp) score=20
RD1_3965 transcriptional regulator RD1:3.823..3.824 Mbp (372 bp) score=20
luxR LuxR family transcriptional regulator RD1:3.824..3.825 Mbp (747 bp) score=20
RD1_3968 MerR family transcriptional regulator RD1:3.825..3.826 Mbp (414 bp) score=20
RD1_3997 GntR family transcriptional regulator RD1:3.855..3.856 Mbp (687 bp) score=20
RD1_4115 transcriptional regulator RD1:3.986..3.987 Mbp (399 bp) score=20
RD1_4140 LysR family transcriptional regulator RD1:4.007..4.008 Mbp (936 bp) score=20
RD1_4146 LysR family transcriptional regulator RD1:4.015..4.016 Mbp (879 bp) score=20
RD1_4149 LysR family transcriptional regulator RD1:4.019..4.02 Mbp (930 bp) score=20
RD1_4157 TetR family transcriptional regulator RD1:4.026..4.026 Mbp (594 bp) score=20
RD1_4181 LysR family transcriptional regulator RD1:4.05..4.051 Mbp (915 bp) score=20
RD1_A0032 transcriptional regulator (Ypuh-like), putative RD1:4.161..4.161 Mbp (630 bp) score=20
RD1_A0099 LysR family transcriptional regulator RD1:4.226..4.227 Mbp (915 bp) score=20
RD1_A0101 AraC family transcriptional regulator RD1:4.229..4.23 Mbp (570 bp) score=20
mtrA DNA-binding response regulator RD1:41.73..42.41 kbp (687 bp) score=10
tcrX two-component response regulator RD1:89.29..90.1 kbp (810 bp) score=10
tcrX two-component response regulator RD1:89.29..90.1 kbp (810 bp) score=10
ppa regulatory protein Ppa RD1:142.2..143 kbp (783 bp) score=10
flaF flagellar biosynthesis regulatory protein FlaF RD1:159.6..159.9 kbp (372 bp) score=10
ptsN nitrogen regulatory IIA protein RD1:365.3..365.7 kbp (465 bp) score=10
RD1_0413 response regulator RD1:402.7..403.9 kbp (1.212 kbp) score=10
hrcA Negative regulator of class I heat shock genes (grpE-dnaK-dnaJ and groELS operons). Prevents heat-shock induction of these operons RD1:416..417 kbp (1.035 kbp) score=10
regA photosynthetic apparatus regulatory protein RD1:449.8..450.4 kbp (555 bp) score=10
moxR methanol dehydrogenase regulator moxR RD1:513.7..514.7 kbp (990 bp) score=10
petR DNA-binding response regulator PetR RD1:535.5..536.2 kbp (702 bp) score=10
chrR transcription negative regulator RD1:670.9..671.6 kbp (654 bp) score=10
tenA transcriptional activator RD1:726.8..727.4 kbp (654 bp) score=10
ada ADA regulatory protein RD1:929.3..930.2 kbp (867 bp) score=10
RD1_1178 response regulator RD1:1.143..1.144 Mbp (720 bp) score=10
glnD catalyzes the uridylylation or deuridylylation of the PII nitrogen regulatory protein RD1:1.151..1.154 Mbp (2.808 kbp) score=10
fnrL transcriptional activator protein FnrL RD1:1.231..1.232 Mbp (744 bp) score=10
rpmE RpmE; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially growing Bacilli while YtiA was found after exponential growth; expression of ytiA is controlled by a zinc-specific transcriptional repressor; RpmE contains one zinc ion and a CxxC motif is responsible for this binding; forms an RNP particle along with proteins L5, L18, and L25 and 5S rRNA; found crosslinked to L2 and L25 and EF-G; may be near the peptidyltransferase site of the 50S ribosome RD1:1.263..1.264 Mbp (222 bp) score=10
osp response regulator RD1:1.284..1.285 Mbp (387 bp) score=10
chvI DNA-binding response regulator ChvI RD1:1.323..1.324 Mbp (702 bp) score=10
RD1_1491 response regulator RD1:1.417..1.418 Mbp (462 bp) score=10
hbaR transcriptional activator RD1:1.479..1.479 Mbp (735 bp) score=10
norQ denitrification regulatory protein nirQ RD1:1.483..1.484 Mbp (813 bp) score=10
nosR nitrous oxide reductase regulatory protein NosR RD1:1.486..1.488 Mbp (1.971 kbp) score=10
nosR nitrous-oxide reductase regulatory protein NosR RD1:1.486..1.488 Mbp (1.971 kbp) score=10
rhlR transcriptional activator protein RaiR RD1:1.578..1.579 Mbp (720 bp) score=10
RD1_2178 RpiR family transcription regulator RD1:2.075..2.076 Mbp (873 bp) score=10
oxyR oxidative stress transcription regulator, oxyR RD1:2.092..2.093 Mbp (942 bp) score=10
cheB chemotaxis response regulator protein-glutamate methylesterase RD1:2.149..2.15 Mbp (1.128 kbp) score=10
ftrB transcriptional activator FtrB RD1:2.321..2.322 Mbp (699 bp) score=10
fixK nitrogen fixation regulatory protein fixK RD1:2.34..2.341 Mbp (729 bp) score=10
pleD diguanylate cyclase response regulator RD1:2.414..2.415 Mbp (1.47 kbp) score=10
glnB nitrogen regulatory protein P-II RD1:2.459..2.459 Mbp (339 bp) score=10
glnB nitrogen regulatory protein P-II RD1:2.459..2.459 Mbp (339 bp) score=10
phoU phosphate transport system regulatory protein PhoU RD1:2.527..2.528 Mbp (711 bp) score=10
ntrX nitrogen assimilation regulatory protein RD1:2.632..2.634 Mbp (1.413 kbp) score=10
degU transcription regulatory protein degU RD1:2.68..2.681 Mbp (651 bp) score=10
ilvH acetolactate synthase 3 regulatory subunit RD1:2.683..2.684 Mbp (561 bp) score=10
RD1_2841 response regulator receiver domain-containing protein RD1:2.711..2.712 Mbp (384 bp) score=10
tctD DNA-binding response regulator RD1:2.824..2.825 Mbp (666 bp) score=10
grp glutamate uptake regulatory protein RD1:2.841..2.841 Mbp (471 bp) score=10
cheY chemotaxis response regulator CheY RD1:2.928..2.928 Mbp (366 bp) score=10
RD1_3107 regulatory protein RD1:2.983..2.986 Mbp (3.255 kbp) score=10
ihfA This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control RD1:3.03..3.031 Mbp (339 bp) score=10
fabI-2 Catalyzes a key regulatory step in fatty acid biosynthesis RD1:3.064..3.065 Mbp (876 bp) score=10
RD1_3461 two-component hybrid sensor and regulator RD1:3.331..3.332 Mbp (1.338 kbp) score=10
RD1_3462 two-component response regulator RD1:3.332..3.333 Mbp (678 bp) score=10
atpD Produces ATP from ADP in the presence of a proton gradient across the membrane. The beta chain is a regulatory subunit RD1:3.395..3.396 Mbp (1.425 kbp) score=10
atpG Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is a regulatory subunit RD1:3.396..3.397 Mbp (876 bp) score=10
RD1_3577 sensory box histidine kinase/response regulator RD1:3.437..3.439 Mbp (2.385 kbp) score=10
RD1_3579 LuxR family DNA-binding response regulator RD1:3.44..3.441 Mbp (615 bp) score=10
RD1_3594 two-component response regulator RD1:3.458..3.458 Mbp (915 bp) score=10
RD1_3595 two-component hybrid sensor and regulator RD1:3.458..3.462 Mbp (3.348 kbp) score=10
torR response regulator TorR RD1:3.529..3.53 Mbp (705 bp) score=10
torT periplasmic sensory protein associated with the TorRS two-component regulatory system RD1:3.533..3.534 Mbp (1.011 kbp) score=10
ihfB This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control RD1:3.774..3.775 Mbp (285 bp) score=10
nasT response regulator NasT RD1:4.045..4.046 Mbp (585 bp) score=10
narP nitrate/nitrite response regulator protein RD1:4.119..4.12 Mbp (633 bp) score=10
RD1_A0100 AraC family transcription regulator RD1:4.227..4.228 Mbp (903 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70