- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: OIHEL45:300000..400000, OIHEL45_00330, OIHEL45_t16347, alaS, ZP_02155261, translation initiation factor, MQTIKAAVCHAFDSPLSVEDVLLRAPVSSEVEVTLDAVA.

[Bookmark this] [Upload your own data] [Show banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 80 regions match your request.
Matches on OIHEL45
overview_OIHEL45
OIHEL45_00592 COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) elongation factor P OIHEL45:107.1..107.7 kbp (564 bp) score=60
infA COG0361 Translation initiation factor 1 (IF-1) translation initiation factor IF-1 OIHEL45:146.8..147 kbp (219 bp) score=60
infB COG0532 Translation initiation factor 2 (IF-2; GTPase) translation initiation factor IF-2 OIHEL45:1.146..1.148 Mbp (2.469 kbp) score=60
OIHEL45_14425 COG0290 Translation initiation factor 3 (IF-3) translation initiation factor IF-3 OIHEL45:2.904..2.904 Mbp (414 bp) score=60
OIHEL45_00462 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB OIHEL45:75.75..76.17 kbp (417 bp) score=40
OIHEL45_04030 COG0050 GTPases - translation elongation factors translation elongation factor Tu OIHEL45:805.7..806.9 kbp (1.176 kbp) score=40
OIHEL45_06070 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) OIHEL45:1.209..1.21 Mbp (693 bp) score=30
OIHEL45_06165 COG0532 Translation initiation factor 2 (IF-2; GTPase) OIHEL45:1.224..1.226 Mbp (1.581 kbp) score=30
OIHEL45_07665 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) anti-anti-sigma factor, putative OIHEL45:1.53..1.53 Mbp (339 bp) score=30
OIHEL45_08085 COG0480 Translation elongation factors (GTPases) elongation factor G OIHEL45:1.625..1.627 Mbp (2.127 kbp) score=30
OIHEL45_08090 COG0050 GTPases - translation elongation factors elongation factor Tu OIHEL45:1.627..1.628 Mbp (1.176 kbp) score=30
OIHEL45_12125 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) Anti-Sigma-factor antagonist (STAS) domain protein OIHEL45:2.432..2.433 Mbp (876 bp) score=30
tsf COG0264 Translation elongation factor Ts elongation factor Ts OIHEL45:2.644..2.645 Mbp (876 bp) score=30
OIHEL45_00305 COG0781 Transcription termination factor transcription antitermination factor NusB OIHEL45:46.65..47.13 kbp (477 bp) score=20
OIHEL45_01520 COG0012 Predicted GTPase, probable translation factor OIHEL45:287.2..288.3 kbp (1.098 kbp) score=20
OIHEL45_04815 COG0251 Putative translation initiation inhibitor, yjgF family OIHEL45:939.8..940.1 kbp (351 bp) score=20
dnaA COG0593 ATPase involved in DNA replication initiation chromosomal replication initiation protein OIHEL45:1.105..1.106 Mbp (1.362 kbp) score=20
nusA COG0195 Transcription elongation factor transcription elongation factor NusA OIHEL45:1.149..1.15 Mbp (1.629 kbp) score=20
rho COG1158 Transcription termination factor transcription termination factor Rho OIHEL45:1.19..1.191 Mbp (1.272 kbp) score=20
OIHEL45_07270 COG0251 Putative translation initiation inhibitor, yjgF family OIHEL45:1.458..1.458 Mbp (459 bp) score=20
rbfA COG0858 Ribosome-binding factor A ribosome-binding factor A OIHEL45:1.541..1.542 Mbp (441 bp) score=20
OIHEL45_08625 COG1977 Molybdopterin converting factor, small subunit molybdopterin converting factor, subunit 1 OIHEL45:1.73..1.73 Mbp (246 bp) score=20
OIHEL45_08630 COG0314 Molybdopterin converting factor, large subunit molybdopterin converting factor, subunit 2 OIHEL45:1.73..1.73 Mbp (444 bp) score=20
OIHEL45_08720 COG0009 Putative translation factor (SUA5) OIHEL45:1.744..1.745 Mbp (933 bp) score=20
OIHEL45_08780 COG0782 Transcription elongation factor transcription elongation factor GreA OIHEL45:1.755..1.755 Mbp (471 bp) score=20
moaA COG2896 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein A OIHEL45:2.277..2.278 Mbp (1.008 kbp) score=20
OIHEL45_11580 COG4108 Peptide chain release factor RF-3 peptide chain release factor 3 OIHEL45:2.32..2.321 Mbp (1.692 kbp) score=20
OIHEL45_11830 COG1186 Protein chain release factor B peptide chain release factor 2 OIHEL45:2.371..2.372 Mbp (1.125 kbp) score=20
OIHEL45_12115 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) putative anti-sigma regulatory factor, serine/threonine protein kinase OIHEL45:2.431..2.431 Mbp (441 bp) score=20
OIHEL45_12120 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) OIHEL45:2.431..2.432 Mbp (354 bp) score=20
OIHEL45_12250 COG0233 Ribosome recycling factor ribosome recycling factor OIHEL45:2.46..2.461 Mbp (567 bp) score=20
OIHEL45_12625 COG1197 Transcription-repair coupling factor (superfamily II helicase) transcription-repair coupling factor OIHEL45:2.531..2.534 Mbp (3.471 kbp) score=20
OIHEL45_13670 COG0216 Protein chain release factor A peptide chain release factor 1 OIHEL45:2.752..2.753 Mbp (1.056 kbp) score=20
moaC COG0315 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein C OIHEL45:2.86..2.86 Mbp (474 bp) score=20
OIHEL45_14455 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family xanthine dehydrogenase accessory factor, putative OIHEL45:2.911..2.912 Mbp (960 bp) score=20
tig COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) trigger factor OIHEL45:2.98..2.982 Mbp (1.332 kbp) score=20
OIHEL45_14944 COG0251 Putative translation initiation inhibitor, yjgF family OIHEL45:3..3 Mbp (369 bp) score=20
OIHEL45_15044 COG0251 Putative translation initiation inhibitor, yjgF family OIHEL45:3.015..3.016 Mbp (399 bp) score=20
OIHEL45_17496 COG0251 Putative translation initiation inhibitor, yjgF family OIHEL45:3.491..3.491 Mbp (396 bp) score=20
OIHEL45_19381 COG0782 Transcription elongation factor GreA/GreB family elongation factor OIHEL45:3.832..3.832 Mbp (441 bp) score=20
OIHEL45_19471 COG0251 Putative translation initiation inhibitor, yjgF family OIHEL45:3.846..3.847 Mbp (507 bp) score=20
OIHEL45_20751 COG0251 Putative translation initiation inhibitor, yjgF family OIHEL45:4.095..4.095 Mbp (174 bp) score=20
OIHEL45_20761 COG0782 Transcription elongation factor GreA/GreB family elongation factor OIHEL45:4.096..4.096 Mbp (438 bp) score=20
OIHEL45_00220 RNA polymerase sigma factor OIHEL45:34.34..35.23 kbp (897 bp) score=10
OIHEL45_00370 RNA polymerase sigma factor RpoD OIHEL45:58.01..60.03 kbp (2.016 kbp) score=10
OIHEL45_00445 RNA polymerase sigma-70 factor OIHEL45:73.58..74.18 kbp (597 bp) score=10
ihfB integration host factor subunit beta OIHEL45:188.3..188.6 kbp (285 bp) score=10
OIHEL45_01515 translation-associated GTPase OIHEL45:286.8..287.1 kbp (297 bp) score=10
OIHEL45_03300 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family OIHEL45:644.8..645.5 kbp (759 bp) score=10
OIHEL45_03810 C factor, cell signaling protein, putative OIHEL45:757.7..758.4 kbp (669 bp) score=10
rpoH2 RNA polymerase sigma-32 factor OIHEL45:772.7..773.6 kbp (879 bp) score=10
OIHEL45_03935 COG0728 Uncharacterized membrane protein, putative virulence factor OIHEL45:785.2..786.7 kbp (1.524 kbp) score=10
OIHEL45_04025 elongation factor Tu OIHEL45:805.5..805.7 kbp (150 bp) score=10
OIHEL45_05065 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) OIHEL45:994.5..995.4 kbp (888 bp) score=10
OIHEL45_05130 COG1186 Protein chain release factor B OIHEL45:1.01..1.01 Mbp (423 bp) score=10
OIHEL45_05925 GrpE protein HSP-70 cofactor, putative OIHEL45:1.18..1.181 Mbp (564 bp) score=10
OIHEL45_07660 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) OIHEL45:1.529..1.53 Mbp (468 bp) score=10
OIHEL45_08705 Molybdenum cofactor biosynthesis protein B OIHEL45:1.742..1.742 Mbp (543 bp) score=10
OIHEL45_09453 RNA polymerase sigma factor OIHEL45:1.876..1.876 Mbp (549 bp) score=10
OIHEL45_09508 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase OIHEL45:1.886..1.888 Mbp (2.238 kbp) score=10
OIHEL45_09743 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) OIHEL45:1.934..1.935 Mbp (939 bp) score=10
OIHEL45_09753 COG3175 Cytochrome oxidase assembly factor OIHEL45:1.935..1.936 Mbp (576 bp) score=10
OIHEL45_10193 chromosome replication initiation inhibitor protein OIHEL45:2.022..2.023 Mbp (882 bp) score=10
OIHEL45_10313 COG0593 ATPase involved in DNA replication initiation OIHEL45:2.047..2.048 Mbp (681 bp) score=10
OIHEL45_10408 von Willebrand factor type A domain prot OIHEL45:2.064..2.065 Mbp (750 bp) score=10
OIHEL45_10413 von Willebrand factor type A domain prot OIHEL45:2.065..2.066 Mbp (717 bp) score=10
OIHEL45_11550 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor OIHEL45:2.314..2.315 Mbp (777 bp) score=10
OIHEL45_12105 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) OIHEL45:2.429..2.43 Mbp (1.137 kbp) score=10
OIHEL45_12110 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) OIHEL45:2.43..2.431 Mbp (1.008 kbp) score=10
OIHEL45_12360 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation OIHEL45:2.481..2.483 Mbp (1.383 kbp) score=10
hfq COG1923 Uncharacterized host factor I protein OIHEL45:2.522..2.523 Mbp (240 bp) score=10
OIHEL45_12840 iron-sulfur cluster assembly transcription factor IscR, putative OIHEL45:2.583..2.584 Mbp (462 bp) score=10
OIHEL45_13665 COG2890 Methylase of polypeptide chain release factors OIHEL45:2.751..2.752 Mbp (843 bp) score=10
OIHEL45_13820 integration host factor, alpha subunit OIHEL45:2.779..2.779 Mbp (279 bp) score=10
OIHEL45_14225 molybdenum cofactor biosynthesis protein A, putative OIHEL45:2.86..2.861 Mbp (1.173 kbp) score=10
OIHEL45_14270 COG1138 Cytochrome c biogenesis factor OIHEL45:2.869..2.871 Mbp (1.965 kbp) score=10
OIHEL45_14325 COG3552 Protein containing von Willebrand factor type A (vWA) domain OIHEL45:2.883..2.884 Mbp (1.26 kbp) score=10
OIHEL45_14829 COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) OIHEL45:2.977..2.977 Mbp (291 bp) score=10
OIHEL45_15814 COG4235 Cytochrome c biogenesis factor OIHEL45:3.177..3.178 Mbp (1.23 kbp) score=10
OIHEL45_18801 nuclear receptor binding factor related protein OIHEL45:3.721..3.722 Mbp (981 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70