Roseobase:Jannaschia sp. CCS1

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: Jann:48..1475, Jann_4283, recF, YP_512158, Jann_R0021, Jann_R0043, transcriptional regulator, IAHTLMADRFGLDIGAGLEQPIDIQKGDIFLRLDLDPECPMPALTEIQRMRRHGVKVFNV.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 72 regions match your request.
Matches on Jann
overview_Jann
rpoH2 binds with the catalytic core of RNA polymerase to produce the holoenzyme; sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; sigma-32 is responsible for the expression of heat shock promoters; there are paralogs in Rhizobium and Sinorhizobium; the proteins in this cluster act as secondary heat shock sigma factors; the Rhizobium sigma-32 factor may also be involved in exopolysaccharide production RNA polymerase factor sigma-32 Jann:861.5..862.4 kbp (879 bp) score=70
infC IF-3 has several functions that are required and promote translation initiation including; preventing association of 70S by binding to 30S; monitoring codon-anticodon interactions by promoting disassociation of fMet-tRNA(fMet) from initiation complexes formed on leaderless mRNAs or incorrectly bound noninitiatior tRNAs and complexes with noncanonical start sites; stimulates codon-anticodon interactions at P-site; involved in moving mRNA to the P-site; and in recycling subunits translation initiation factor IF-3 Jann:1.757..1.758 Mbp (666 bp) score=60
Jann_3450 sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; this is the primary sigma factor of bacteria RNA polymerase sigma factor RpoD Jann:3.498..3.5 Mbp (2.007 kbp) score=60
infA stimulates the activities of the other two initiation factors, IF-2 and IF-3 translation initiation factor IF-1 Jann:2.893..2.894 Mbp (219 bp) score=50
infB Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to the 30S ribosomal subunits during initiation of protein synthesis. Also involved in the hydrolysis of GTP during the formation of the 70S ribosomal complex translation initiation factor IF-2 Jann:35.19..37.66 kbp (2.475 kbp) score=40
rplL present in two forms; L12 is normal, while L7 is aminoacylated at the N-terminal serine; the only multicopy ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two L12 dimers bind L10; critically important for translation efficiency and fidelity; stimulates GTPase activity of translation factors Jann:551.5..551.9 kbp (375 bp) score=30
Jann_0648 Bacteria have multiple sigma factors which are active under specific conditions; the sigma factor binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription RNA polymerase sigma factor Jann:619.6..620.1 kbp (543 bp) score=30
ihfA This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control integration host factor subunit alpha Jann:1.772..1.772 Mbp (303 bp) score=30
prfA recognizes the termination signals UAG and UAA during protein translation a specificity which is dependent on amino acid residues residing in loops of the L-shaped tRNA-like molecule of RF1; this protein is similar to release factor 2 peptide chain release factor 1 Jann:1.795..1.796 Mbp (1.065 kbp) score=30
prfB recognizes the termination signals UGA and UAA during protein translation a specificity which is dependent on amino acid residues residing in loops of the L-shaped tRNA-like molecule of RF2; in some organisms control of PrfB protein levels is maintained through a +1 ribosomal frameshifting mechanism; this protein is similar to release factor 1 peptide chain release factor 2 Jann:2.533..2.534 Mbp (1.128 kbp) score=30
Jann_3134 Bacteria have multiple sigma factors which are active under specific conditions; the sigma factor binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription RNA polymerase sigma factor Jann:3.174..3.175 Mbp (585 bp) score=30
Jann_3565 Bacteria have multiple sigma factors which are active under specific conditions; the sigma factor binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription RNA polymerase sigma factor Jann:3.63..3.631 Mbp (549 bp) score=30
Jann_3582 translation-associated GTPase; the crystal structure of the Haemophilus influenzae YchF protein showed similarity to the yeast structure (PDB: 1NI3); fluorescence spectroscopy revealed nucleic acid binding; the yeast protein YBR025c interacts with the translation elongation factor eEF1 Jann:3.66..3.661 Mbp (1.098 kbp) score=30
ihfB This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control integration host factor subunit beta Jann:3.664..3.665 Mbp (288 bp) score=30
dnaA binds to the dnaA-box as an ATP-bound complex at the origin of replication during the initiation of chromosomal replication; can also affect transcription of multiple genes including itself. chromosomal replication initiation protein Jann:48 bp..1.475 kbp (1.428 kbp) score=20
greA necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites; arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by cleavage factors such as GreA or GreB allows the resumption of elongation from the new 3'terminus transcription elongation factor GreA Jann:496.9..497.4 kbp (471 bp) score=20
Jann_0555 EF-Tu; promotes GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis; when the tRNA anticodon matches the mRNA codon, GTP hydrolysis results; the inactive EF-Tu-GDP leaves the ribosome and release of GDP is promoted by elongation factor Ts; many prokaryotes have two copies of the gene encoding EF-Tu elongation factor Tu Jann:543.6..544.8 kbp (1.176 kbp) score=20
Jann_0577 EF-G; promotes GTP-dependent translocation of the ribosome during translation; many organisms have multiple copies of this gene elongation factor G Jann:565.5..567.6 kbp (2.121 kbp) score=20
Jann_0578 EF-Tu; promotes GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis; when the tRNA anticodon matches the mRNA codon, GTP hydrolysis results; the inactive EF-Tu-GDP leaves the ribosome and release of GDP is promoted by elongation factor Ts; many prokaryotes have two copies of the gene encoding EF-Tu elongation factor Tu Jann:567.6..568.8 kbp (1.176 kbp) score=20
ksgA catalyzes the transfer of a total of four methyl groups from S-adenosyl-l-methionine (S-AdoMet) to two adjacent adenosine bases A1518 and A1519 in 16S rRNA; mutations in ksgA causes resistance to the translation initiation inhibitor kasugamycin Jann:1.797..1.798 Mbp (918 bp) score=20
moaC MoaC; along with MoaA is involved in conversion of a guanosine derivative into molybdopterin precursor Z; involved in molybdenum cofactor biosynthesis molybdenum cofactor biosynthesis protein MoaC Jann:1.865..1.866 Mbp (492 bp) score=20
tsf EF-Ts; functions during elongation stage of protein translation; forms a dimer; associates with EF-Tu-GDP complex and promotes exchange of GDP to GTP resulting in regeneration of the active form of EF-Tu elongation factor Ts Jann:2.309..2.31 Mbp (876 bp) score=20
Jann_3400 binds with the catalytic core of RNA polymerase to produce the holoenzyme; this sigma factor is responsible for the expression of heat shock promoters RNA polymerase factor sigma-32 Jann:3.452..3.453 Mbp (897 bp) score=20
Jann_3895 translation factor SUA5 Jann:3.992..3.993 Mbp (945 bp) score=20
smpB binds to ssrA RNA (tmRNA) and is required for its successful binding to ribosomes; also appears to function in the trans-translation step by promoting accommodation of tmRNA into the ribosomal A site; SmpB protects the tmRNA from RNase R degradation in Caulobacter crescentus; both the tmRNA and SmpB are regulated in cell cycle-dependent manner; functions in release of stalled ribosomes from damaged mRNAs and targeting proteins for degradation Jann:28.5..28.98 kbp (477 bp) score=10
nusA transcription elongation factor NusA Jann:38.31..40.09 kbp (1.773 kbp) score=10
rho transcription termination factor Rho Jann:189..190.3 kbp (1.209 kbp) score=10
Jann_0284 Regulatory factor involved in maltose metabolism Jann:289.7..290.4 kbp (726 bp) score=10
Jann_0462 molybdenum cofactor guanylyltransferase Jann:462.4..463 kbp (537 bp) score=10
rpoB DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates; beta subunit is part of the catalytic core which binds with a sigma factor to produce the holoenzyme Jann:552.1..556.3 kbp (4.158 kbp) score=10
Jann_0569 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Subunit beta' binds to sigma factor allowing it to bind to the -10 region of the promoter Jann:556.6..560.8 kbp (4.215 kbp) score=10
rpsC forms a complex with S10 and S14; binds the lower part of the 30S subunit head and the mRNA in the complete ribosome to position it for translation Jann:576..576.8 kbp (744 bp) score=10
rpsQ primary binding protein; helps mediate assembly; involved in translation fidelity Jann:581.6..581.8 kbp (231 bp) score=10
rpsE located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body; contacts S4 and S8; with S4 and S12 plays a role in translational accuracy; mutations in this gene result in spectinomycin resistance Jann:584.9..585.5 kbp (594 bp) score=10
Jann_0621 recombination factor protein RarA Jann:594.2..595.5 kbp (1.311 kbp) score=10
Jann_0841 von Willebrand factor A Jann:796.1..798.2 kbp (2.061 kbp) score=10
Jann_0842 FecI-like sigma-24 factor Jann:798.2..798.8 kbp (603 bp) score=10
Jann_0935 molybdenum cofactor sulfurylase Jann:890.1..890.9 kbp (771 bp) score=10
rpsD primary rRNA binding protein; nucleates 30S assembly; involved in translational accuracy with proteins S5 and S12; interacts with protein S5; involved in autogeneously regulating ribosomal proteins by binding to pseudoknot structures in the polycistronic mRNA; interacts with transcription complex and functions similar to protein NusA in antitermination Jann:913.5..914.2 kbp (621 bp) score=10
thyX flavin dependent thymidylate synthase; ThyX; thymidylate synthase complementing protein; catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate; the enzyme from Mycobacterium tuberculosis forms homotetramers; uses FAD as a cofactor Jann:1.054..1.055 Mbp (957 bp) score=10
Jann_1203 peptide chain release factor 3 Jann:1.164..1.166 Mbp (1.638 kbp) score=10
Jann_1571 virulence factor MCE-like protein Jann:1.548..1.55 Mbp (2.427 kbp) score=10
tig trigger factor Jann:1.601..1.603 Mbp (1.326 kbp) score=10
Jann_1721 von Willebrand factor, type A Jann:1.706..1.71 Mbp (4.071 kbp) score=10
Jann_1760 von Willebrand factor A Jann:1.748..1.75 Mbp (1.26 kbp) score=10
gltX Charges one glutamine molecule and pairs it to its corresponding RNA trinucleotide during protein translation Jann:1.828..1.829 Mbp (1.413 kbp) score=10
gltX Charges one glutamine molecule and pairs it to its corresponding RNA trinucleotide during protein translation Jann:1.828..1.829 Mbp (1.413 kbp) score=10
Jann_1890 FecI-like sigma-24 factor Jann:1.879..1.88 Mbp (585 bp) score=10
ilvH with IlvI catalyzes the formation of 2-acetolactate from pyruvate, the small subunit is required for full activity and valine sensitivity; E.coli produces 3 isoenzymes of acetolactate synthase which differ in specificity to substrates, valine sensitivity and affinity for cofactors; also known as acetolactate synthase 3 small subunit Jann:1.881..1.882 Mbp (558 bp) score=10
Jann_2093 von Willebrand factor A Jann:2.101..2.103 Mbp (1.182 kbp) score=10
rpmA involved in the peptidyltransferase reaction during translation Jann:2.288..2.288 Mbp (270 bp) score=10
Jann_2322 transcription-repair coupling factor Jann:2.325..2.329 Mbp (3.462 kbp) score=10
rpsI forms a direct contact with the tRNA during translation Jann:2.421..2.421 Mbp (495 bp) score=10
Jann_2458 ribosome recycling factor Jann:2.452..2.453 Mbp (732 bp) score=10
miaA IPP transferase; isopentenyltransferase; involved in tRNA modification; in Escherichia coli this enzyme catalyzes the addition of a delta2-isopentenyl group from dimethylallyl diphosphate to the N6-nitrogen of adenosine adjacent to the anticodon of tRNA species that read codons starting with uracil; further tRNA modifications may occur; mutations in miaA result in defects in translation efficiency and fidelity Jann:2.455..2.456 Mbp (867 bp) score=10
Jann_2665 putative mRNA 3-end processing factor Jann:2.676..2.677 Mbp (1.008 kbp) score=10
Jann_2963 catalyzes the conversion of dihydroorotate to orotate in the pyrimidine biosynthesis pathway; uses a flavin nucleotide as an essential cofactor; class 2 enzymes are monomeric and compared to the class 1 class 2 possess an extended N terminus, which plays a role in the membrane association of the enzyme and provides the binding site for the respiratory quinones that serve as physiological electron acceptors Jann:2.983..2.984 Mbp (1.047 kbp) score=10
Jann_3077 sigma-54 factor protein Jann:3.111..3.112 Mbp (1.371 kbp) score=10
Jann_3254 elongation factor P Jann:3.304..3.305 Mbp (564 bp) score=10
moaA molybdenum cofactor biosynthesis protein A Jann:3.34..3.341 Mbp (1.038 kbp) score=10
Jann_3412 NusB antitermination factor Jann:3.461..3.461 Mbp (498 bp) score=10
Jann_3592 Enables the recycling of peptidyl-tRNAs produced at termination of translation Jann:3.669..3.67 Mbp (720 bp) score=10
Jann_3621 part of multienzyme complex composed of H, L, P, and T proteins which catalyzes oxidation of glycine to yield carbon dioxide, ammonia, 5,10-CH2-H4folate and a reduced pyridine nucleotide; protein H is involved in transfer of methylamine group from the P to T protein; covalently bound to a lipoyl cofactor Jann:3.693..3.694 Mbp (363 bp) score=10
Jann_4021 FecI-like sigma-24 factor Jann:4.125..4.125 Mbp (384 bp) score=10
Jann_4022 anti-sigm factor, ChrR Jann:4.125..4.126 Mbp (642 bp) score=10
rpsO primary rRNA binding protein; helps nucleate assembly of 30S; binds directly to the 16S rRNA and an intersubunit bridge to the 23S rRNA; autoregulates translation through interactions with the mRNA leader sequence Jann:4.135..4.135 Mbp (270 bp) score=10
rbfA ribosome-binding factor A Jann:4.14..4.14 Mbp (432 bp) score=10
Jann_4051 anti-sigma-factor antagonist domain-containing protein Jann:4.156..4.156 Mbp (348 bp) score=10
Jann_4052 putative anti-sigma regulatory factor Jann:4.156..4.156 Mbp (513 bp) score=10
Jann_4157 anti-sigm factor, ChrR Jann:4.269..4.27 Mbp (660 bp) score=10
flaF acts as an activator of flagellin translation and may be required for filament secretion or assembly; Bradyrhizobium has one thick flagellum and several thin flagella; the Bradyrhizobium protein in this cluster is associated with the thick flagellum Jann:4.307..4.308 Mbp (375 bp) score=10
rpsT binds directly to the 16S rRNA and is involved in post-translational inhibition of arginine and ornithine decarboxylase Jann:4.317..4.317 Mbp (267 bp) score=10

- Tracks
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70