Roseobase: Dinoroseobacter shibae DFL 12

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: Dshi:300000..400000, Dshi_0024, Dshi_6031, dmdA, dimethyl sulfoniopropionate demethylase, YP_001533657, MANQPMLKFVKIPKDMPEKRDADTRKQDFDEIYQEY.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 3 regions match your request.
Matches on Dshi
overview_Dshi
cobC PFAM: aminotransferase class I and II KEGG: sil:SPO3224 cobalamin biosynthetic protein CobC; gene arrangement with several genes upstream (Dshi_0157) to downstream (Dshi_0175); L-threonine-O-3-phosphate decarboxylase Dshi:170.3..171.2 kbp (957 bp) score=10
cbiG Dshi_0175 Dshi:178.7..180.5 kbp (1.806 kbp) score=10
cbiG Dshi_0175 Dshi:178.7..180.5 kbp (1.806 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70