Roseobase: Dinoroseobacter shibae DFL 12

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: Dshi:300000..400000, Dshi_0024, Dshi_6031, dmdA, dimethyl sulfoniopropionate demethylase, YP_001533657, MANQPMLKFVKIPKDMPEKRDADTRKQDFDEIYQEY.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 114 regions match your request.
Matches on Dshi
overview_Dshi
frr Rrf; Frr; ribosome-recycling factor; release factor 4; RF4; recycles ribosomes upon translation termination along with release factor RF-3 and elongation factor EF-G; A GTPase-dependent process results in release of 50S from 70S; inhibited by release factor RF-1; essential for viability; structurally similar to tRNAs ribosome recycling factor Dshi:1.554..1.554 Mbp (567 bp) score=70
rpoH2 binds with the catalytic core of RNA polymerase to produce the holoenzyme; sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; sigma-32 is responsible for the expression of heat shock promoters; there are paralogs in Rhizobium and Sinorhizobium; the proteins in this cluster act as secondary heat shock sigma factors; the Rhizobium sigma-32 factor may also be involved in exopolysaccharide production RNA polymerase factor sigma-32 Dshi:3.145..3.146 Mbp (882 bp) score=70
infC IF-3 has several functions that are required and promote translation initiation including; preventing association of 70S by binding to 30S; monitoring codon-anticodon interactions by promoting disassociation of fMet-tRNA(fMet) from initiation complexes formed on leaderless mRNAs or incorrectly bound noninitiatior tRNAs and complexes with noncanonical start sites; stimulates codon-anticodon interactions at P-site; involved in moving mRNA to the P-site; and in recycling subunits translation initiation factor IF-3 Dshi:1.176..1.176 Mbp (609 bp) score=60
rpoD sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; this is the primary sigma factor of bacteria RNA polymerase sigma factor RpoD Dshi:2.382..2.384 Mbp (1.995 kbp) score=60
Dshi_0019 TIGRFAM: small GTP-binding protein; GTP-binding protein TypA PFAM: elongation factor G domain protein; protein synthesis factor GTP-binding; elongation factor Tu domain 2 protein KEGG: rde:RD1_2707 GTP-binding protein TypA, putative, high swissprot hit to GTP-binding protein TypA/BipA homolog from Helicobacter pylori, diverse translation and elongation factor domains Dshi:22.87..24.68 kbp (1.818 kbp) score=50
Dshi_0073 TIGRFAM: anti-anti-sigma factor PFAM: Sulfate transporter/antisigma-factor antagonist STAS KEGG: rsq:Rsph17025_2906 anti-sigma-factor antagonist, SpoIIAA domain: The establishment of differential gene expression in sporulating Bacillus subtilis involves four protein components one of which is SpoIIAA (). The four components regulate the sporulation sigma factor F. Early in sporulation, SpoIIAA is in the phosphorylated state (SpoIIAA-P), as a result anti-sigma-factor antagonist Dshi:73.26..73.59 kbp (333 bp) score=50
greA2 PFAM: transcription elongation factor GreA/GreB domain protein, NCBI conserved domains: COG0782, GreA, Transcription elongation factor, bad swissprot hit to Transcription elongation factor greA from Sinorhizobium meliloti; middle gb hit to GreA/GreB family elongation factor [Oceanibulbus indolifex HEL-45]. GreA/GreB family elongation factor Dshi:544.5..544.9 kbp (432 bp) score=50
infA stimulates the activities of the other two initiation factors, IF-2 and IF-3 translation initiation factor IF-1 Dshi:1.003..1.003 Mbp (219 bp) score=50
moaD TIGRFAM: molybdopterin converting factor, subunit 1 PFAM: thiamineS protein KEGG: rsp:RSP_1072 putative molybdopterin MPT converting factor, subunit 1 protein; Neigbhorhood; Molybdopterin-converting factor small subunit; Molybdenum cofactor biosynthesis protein D; Molybdopterin synthase subunit 1; MPT synthase subunit 1 molybdopterin-converting factor subunit 1 Dshi:3.271..3.271 Mbp (252 bp) score=50
Dshi_2834 Swiss-Prot: O05467-Virulence factor mviN homolog TIGRFAM: integral membrane protein MviN PFAM: virulence factor MVIN family protein COG072: Uncharacterized membrane protein, putative virulence factor; mviN homolog putative virulence factor Dshi:2.992..2.993 Mbp (1.605 kbp) score=40
moaB TIGRFAM: molybdenum cofactor synthesis domain; molybdenum cofactor biosynthesis protein B PFAM: molybdopterin binding domain KEGG: sil:SPO0291 molybdenum cofactor biosynthesis protein B molybdenum cofactor biosynthesis protein B Dshi:3.259..3.259 Mbp (543 bp) score=40
moaE PFAM: molybdopterin biosynthesis MoaE protein KEGG: sil:SPO3633 molybdopterin converting factor, subunit 2; Molybdopterin-converting factor large subunit; Molybdenum cofactor biosynthesis protein E; Molybdopterin synthase subunit 2; MPT synthase subunit 2 molybdopterin-converting factor subunit 2 Dshi:3.27..3.271 Mbp (444 bp) score=40
infB Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to the 30S ribosomal subunits during initiation of protein synthesis. Also involved in the hydrolysis of GTP during the formation of the 70S ribosomal complex translation initiation factor IF-2 Dshi:3.749..3.751 Mbp (2.499 kbp) score=40
rpoN TIGRFAM: RNA polymerase sigma-54 factor, RpoN PFAM: sigma-54 factor; sigma-54 factor core-binding region; sigma-54 DNA-binding domain protein KEGG: rsh:Rsph17029_2179 RNA polymerase, sigma 54 subunit, RpoN RNA polymerase sigma-54 factor Dshi:3.775..3.776 Mbp (1.317 kbp) score=40
nusG TIGRFAM: transcription termination/antitermination factor NusG PFAM: KOW domain protein; NGN domain protein KEGG: rsq:Rsph17025_2547 NusG antitermination factor NusG antitermination factor Dshi:256.7..257.2 kbp (534 bp) score=30
rplL present in two forms; L12 is normal, while L7 is aminoacylated at the N-terminal serine; the only multicopy ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two L12 dimers bind L10; critically important for translation efficiency and fidelity; stimulates GTPase activity of translation factors Dshi:262.4..262.8 kbp (381 bp) score=30
chrR1 TIGRFAM: anti-sigma factor, putative, ChrR family PFAM: Cupin 2 conserved barrel domain protein; good swissprot to Transcriptional activator chrR from Rhodobacter sphaeroides 2.4.1 and good Ref ZP hit to Anti-sigma factor ChrR from Roseovarius sp. TM1035; NCBI conserved domains: chrR; ChrR anti-ECFsigma factor Dshi:349.2..349.9 kbp (672 bp) score=30
rpoE2 Member of the extracytoplasmic function sigma factors which are active under specific conditions; binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription; this sigma factor is involved in heat shock and oxidative stress response RNA polymerase sigma factor RpoE Dshi:349.9..350.4 kbp (570 bp) score=30
Dshi_0414 KEGG: pde:Pden_4724 GreA/GreB family elongation factor; bad swissprot hit to Transcription elongation factor greA from Brucella suis; middle Ref ZP hit to putative nucleoside diphosphate kinase regulator from Oceanicola batsensis HTCC2597; NCBI conserved domains: PRK05753, nucleoside diphosphate kinase regulator and GreA/B GreA/GreB family elongation factor Dshi:408.4..408.9 kbp (447 bp) score=30
Dshi_0598 PFAM: short-chain dehydrogenase/reductase SDR; NCBI conserved domains: PRK09009, C factor cell-cell signaling protein and PRK06953, short chain dehydrogenase; low swissprot hit to C-factor (C signal) from Myxococcus xanthus; high Ref YP hit to C factor, cell signaling protein, putative [Roseobacter denitrificans OCh 114]. Dshi:589.8..590.4 kbp (666 bp) score=30
Dshi_0711 specific inhibitor of chromosomal initiation of replication in vitro; binds the three 13-mers in the origin (oriC) to block initiation of replication; also controls genes involved in arginine transport chromosome replication initiation inhibitor protein Dshi:719.3..720.2 kbp (927 bp) score=30
engD translation-associated GTPase; the crystal structure of the Haemophilus influenzae YchF protein showed similarity to the yeast structure (PDB: 1NI3); fluorescence spectroscopy revealed nucleic acid binding; the yeast protein YBR025c interacts with the translation elongation factor eEF1 Dshi:978.8..979.9 kbp (1.098 kbp) score=30
ihfB This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control integration host factor subunit beta Dshi:1.063..1.063 Mbp (288 bp) score=30
prfB recognizes the termination signals UGA and UAA during protein translation a specificity which is dependent on amino acid residues residing in loops of the L-shaped tRNA-like molecule of RF2; in some organisms control of PrfB protein levels is maintained through a +1 ribosomal frameshifting mechanism; this protein is similar to release factor 1 peptide chain release factor 2 Dshi:1.204..1.205 Mbp (1.128 kbp) score=30
mfd SWISSPROT P30958: Transcription-repair-coupling factor, TIGRFAM: TIGR00580 -Transcription-repair coupling factor; PFAM: PF03461, PF02559, PF00270, PF00271 transcription repair coupling factor Dshi:1.622..1.626 Mbp (3.483 kbp) score=30
ihfA This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control integration host factor subunit alpha Dshi:1.788..1.789 Mbp (306 bp) score=30
prfA recognizes the termination signals UAG and UAA during protein translation a specificity which is dependent on amino acid residues residing in loops of the L-shaped tRNA-like molecule of RF1; this protein is similar to release factor 2 peptide chain release factor 1 Dshi:1.8..1.801 Mbp (1.056 kbp) score=30
Dshi_3835 Bacteria have multiple sigma factors which are active under specific conditions; the sigma factor binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription RNA polymerase sigma factor Dshi:4.025..4.026 Mbp (564 bp) score=30
rsbW KEGG: rde:RD1_0027 serine-protein kinase, putative; COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase); ATP-binding region is related to ATPase domains of histidine kinase; Anti-sigma-B factor Dshi:72.74..73.25 kbp (510 bp) score=20
Dshi_0137 PFAM: Endoribonuclease L-PSP COG0251-Putative translation initiation inhibitor, yjgF family Dshi:135.4..135.9 kbp (468 bp) score=20
tufA2 EF-Tu; promotes GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis; when the tRNA anticodon matches the mRNA codon, GTP hydrolysis results; the inactive EF-Tu-GDP leaves the ribosome and release of GDP is promoted by elongation factor Ts; many prokaryotes have two copies of the gene encoding EF-Tu elongation factor Tu Dshi:220.9..222.1 kbp (1.176 kbp) score=20
fusA EF-G; promotes GTP-dependent translocation of the ribosome during translation; many organisms have multiple copies of this gene elongation factor G Dshi:275.5..277.6 kbp (2.118 kbp) score=20
tufA1 EF-Tu; promotes GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis; when the tRNA anticodon matches the mRNA codon, GTP hydrolysis results; the inactive EF-Tu-GDP leaves the ribosome and release of GDP is promoted by elongation factor Ts; many prokaryotes have two copies of the gene encoding EF-Tu elongation factor Tu Dshi:277.7..278.9 kbp (1.176 kbp) score=20
Dshi_0459 PFAM: von Willebrand factor type A KEGG: rde:RD1_0875 hypothetical protein; bad swissprot hit to Uncharacterized protein BB_0173 from Borrelia burgdorferi, unsure GC frame plot von Willebrand factor type A Dshi:445.3..446.2 kbp (963 bp) score=20
ksgA catalyzes the transfer of a total of four methyl groups from S-adenosyl-l-methionine (S-AdoMet) to two adjacent adenosine bases A1518 and A1519 in 16S rRNA; mutations in ksgA causes resistance to the translation initiation inhibitor kasugamycin Dshi:1.221..1.222 Mbp (843 bp) score=20
tsf EF-Ts; functions during elongation stage of protein translation; forms a dimer; associates with EF-Tu-GDP complex and promotes exchange of GDP to GTP resulting in regeneration of the active form of EF-Tu elongation factor Ts Dshi:1.612..1.613 Mbp (876 bp) score=20
Dshi_1784 TIGRFAM: TIGR02937 RNA polymerase sigma factor, sigma-70 family; COG: COG1595 - DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog; PFAM: PF08281, PF04542 putative RNA polymerase sigma factor Dshi:1.853..1.854 Mbp (543 bp) score=20
moaC MoaC; along with MoaA is involved in conversion of a guanosine derivative into molybdopterin precursor Z; involved in molybdenum cofactor biosynthesis molybdenum cofactor biosynthesis protein MoaC Dshi:1.873..1.874 Mbp (477 bp) score=20
Dshi_2656 in Rhizobium meliloti this protein is involved in the synthesis of nodulation factors that are active on the roots of alfalfa; catalyzes formation of activated sulfate intermediate; converts ATP and sulfate to diphosphate and adenylylsulfate and then ATP and adenylyl sulfate to ADP and 3'-phosphoadenylyl sulfate; the activated intermediate is transferred to the nodulation factors by NodH; may interact with NodP and NodQ; similar to the CysD and CysN proteins from Escherichia coli involved in cysteine biosynthesis Dshi:2.812..2.814 Mbp (2.076 kbp) score=20
rpoH2 binds with the catalytic core of RNA polymerase to produce the holoenzyme; this sigma factor is responsible for the expression of heat shock promoters RNA polymerase factor sigma-32 Dshi:3.145..3.146 Mbp (882 bp) score=20
greA necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites; arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by cleavage factors such as GreA or GreB allows the resumption of elongation from the new 3'terminus transcription elongation factor GreA Dshi:3.245..3.245 Mbp (516 bp) score=20
Dshi_3116 PFAM:VWA von Willebrand factor type A domain KEGG: rde:RD1_0526 hypothetical protein,TMH von Willebrand factor type A domain-containing protein Dshi:3.283..3.284 Mbp (987 bp) score=20
norD PFAM: von Willebrand factor type A KEGG: sil:SPOA0214 nitric oxide reductase D protein pde:Pden_2481 von Willebrand factor, type A Dshi:3.35..3.352 Mbp (1.935 kbp) score=20
dnaA binds to the dnaA-box as an ATP-bound complex at the origin of replication during the initiation of chromosomal replication; can also affect transcription of multiple genes including itself. chromosomal replication initiation protein Dshi:3.545..3.546 Mbp (1.383 kbp) score=20
rpoE1 TIGRFAM: RNA polymerase sigma-70 PFAM: sigma-70 region 2 domain protein; sigma-70 region 4 domain protein; Sigma-70 region 4 type 2; (sigma-70 factor family, ECF subfamily) RNA polymerase sigma factor Dshi:3.604..3.604 Mbp (576 bp) score=20
Dshi_3461 PFAM: Endoribonuclease L-PSP KEGG: rsp:RSP_1223 putative translation initiation inhibitor, YjgF family / putative endoribonuclease L-PSP Dshi:3.643..3.643 Mbp (378 bp) score=20
chrR2 transcriptional activator anti-ECFsigma factor Dshi:29.14..29.81 kbp (672 bp) score=10
sfsA Regulatory factor involved in maltose metabolism Dshi:117.4..118.2 kbp (735 bp) score=10
mogA molybdenum cofactor biosynthesis protein MogA Dshi:118.2..119 kbp (729 bp) score=10
smpB binds to ssrA RNA (tmRNA) and is required for its successful binding to ribosomes; also appears to function in the trans-translation step by promoting accommodation of tmRNA into the ribosomal A site; SmpB protects the tmRNA from RNase R degradation in Caulobacter crescentus; both the tmRNA and SmpB are regulated in cell cycle-dependent manner; functions in release of stalled ribosomes from damaged mRNAs and targeting proteins for degradation Dshi:147.4..147.9 kbp (483 bp) score=10
rpoB DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates; beta subunit is part of the catalytic core which binds with a sigma factor to produce the holoenzyme Dshi:264.8..268.9 kbp (4.137 kbp) score=10
rpoC DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Subunit beta' binds to sigma factor allowing it to bind to the -10 region of the promoter Dshi:269..273.3 kbp (4.248 kbp) score=10
rpsC forms a complex with S10 and S14; binds the lower part of the 30S subunit head and the mRNA in the complete ribosome to position it for translation Dshi:286.9..287.6 kbp (723 bp) score=10
rpsE located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body; contacts S4 and S8; with S4 and S12 plays a role in translational accuracy; mutations in this gene result in spectinomycin resistance Dshi:293.8..294.4 kbp (576 bp) score=10
Dshi_0313 recombination factor protein RarA Dshi:301.8..303.1 kbp (1.311 kbp) score=10
Dshi_0317 PFAM: ATP12 ATPase KEGG: rsp:RSP_1746 hypothetical protein; good Ref hits to ATP12 proteins, also middle swissprot hit toATP synthase mitochondrial F1 complex assembly factor 2, mitochondrial precursor (ATP12 homolog) from Homo sapiens Dshi:305.2..305.9 kbp (705 bp) score=10
mosc PFAM: MOSC domain containing protein; MOSC domain protein beta barrel domain protein KEGG: sil:SPO0531 MOSC domain protein, swissprot hit to Molybdenum cofactor sulfurase from Mus musculus Dshi:314.4..315.1 kbp (750 bp) score=10
Dshi_0460 no significant swissprot, unsure GC frame plot; NCBI conserved domains: VWA domain (von Willebrand factor); high Ref YP hit to hypothetical protein RD1_0876 from Roseobacter denitrificans OCh 114 Dshi:446.2..447.1 kbp (900 bp) score=10
Dshi_0478 SMART: extracellular solute-binding protein family ; NCBI conserved domains: PbPb; low swissprot hit to Protein moxJ precursor from Methylobacterium extorquens (May be involved in the assemblage of active methanoldehydrogenase and/or its cofactor PQQ in the periplasm); high Ref YP hit to putative methanol oxidation protein from Roseobacter denitrificans OCh 114 Dshi:463.3..464.1 kbp (849 bp) score=10
deoR3 PFAM: putative sugar-binding domain protein; NCBI conserved domains: pfam04198, Sugar-bind, Putative sugar-binding domain; COG2390, DeoR, Transcriptional regulator, contains sigma factor-related N-terminal domain, good swissprot hit to Uncharacterized transcriptional regulator yjhU from Escherichia coli K12 (related to SorC); high Ref YP hit to transcriptional regulator, putative [Roseobacter denitrificans OCh 114]; DeoR family Dshi:507.2..508.2 kbp (960 bp) score=10
Dshi_0635 PFAM: cyclic nucleotide-binding; Sulfate transporter/antisigma-factor antagonist STAS; Xanthine/uracil/vitamin C permease; sulphate transporter; low swissprot hit to Uncharacterized vacuolar membrane protein YGR125W from Saccharomyces cerevisiae; high Ref YP hit to Sulfate permease and related transporters [Magnetospirillum magneticum AMB-1]. Dshi:633.4..635.6 kbp (2.202 kbp) score=10
thyX flavin dependent thymidylate synthase; ThyX; thymidylate synthase complementing protein; catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate; the enzyme from Mycobacterium tuberculosis forms homotetramers; uses FAD as a cofactor Dshi:775.2..776.1 kbp (918 bp) score=10
pyrD2 catalyzes the conversion of dihydroorotate to orotate in the pyrimidine biosynthesis pathway; uses a flavin nucleotide as an essential cofactor; class 2 enzymes are monomeric and compared to the class 1 class 2 possess an extended N terminus, which plays a role in the membrane association of the enzyme and provides the binding site for the respiratory quinones that serve as physiological electron acceptors Dshi:856.5..857.5 kbp (1.059 kbp) score=10
thiD cofactor biosynthesis, Reaction: ATP + 4-amino-2-methyl-5-phosphomethylpyrimidine <=> ADP + 4-amino-2-methyl-5-diphosphomethylpyrimidine Dshi:936.8..937.6 kbp (798 bp) score=10
pthA Enables the recycling of peptidyl-tRNAs produced at termination of translation Dshi:971.8..972.5 kbp (708 bp) score=10
coxE Protein containing von Willebrand factor type A (vWA) domain Dshi:1.254..1.255 Mbp (1.179 kbp) score=10
moaA molybdenum cofactor biosynthesis protein A Dshi:1.343..1.344 Mbp (1.011 kbp) score=10
prfC peptide chain release factor 3 Dshi:1.389..1.391 Mbp (1.608 kbp) score=10
Dshi_1343 Sec-independent translocation protein mttA/Hcf106, Members of this protein family are involved in a sec independent translocation mechanism. This sec-independent pathway is termed TAT for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export. Dshi:1.397..1.397 Mbp (225 bp) score=10
Dshi_1380 This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. Dshi:1.433..1.434 Mbp (1.407 kbp) score=10
Dshi_1408 Signal transducing histidine kinases are the key elements in two-component signal transduction systems, which control complex processes such as the initiation of development in microorganisms Dshi:1.461..1.464 Mbp (2.694 kbp) score=10
Dshi_1425 This family of dehydrogenases act on aldehyde substrates. Members use NADP as a cofactor (PFAM, INTERPRO; COG: NAD-dependent enzyme). Dshi:1.478..1.48 Mbp (1.455 kbp) score=10
Dshi_1430 This family of dehydrogenases act on aldehyde substrates. Members use NADP as a cofactor. Dshi:1.486..1.487 Mbp (1.464 kbp) score=10
rpmA involved in the peptidyltransferase reaction during translation Dshi:1.518..1.519 Mbp (270 bp) score=10
miaA IPP transferase; isopentenyltransferase; involved in tRNA modification; in Escherichia coli this enzyme catalyzes the addition of a delta2-isopentenyl group from dimethylallyl diphosphate to the N6-nitrogen of adenosine adjacent to the anticodon of tRNA species that read codons starting with uracil; further tRNA modifications may occur; mutations in miaA result in defects in translation efficiency and fidelity Dshi:1.552..1.553 Mbp (891 bp) score=10
ecfE Zinc-Metalloprotease; Degrades both heat shock sigma factors rpoE and rpoH. Dshi:1.557..1.558 Mbp (1.338 kbp) score=10
ntrX SWISSPROT: P03029 - Nitrogen assimilation regulatory protein ntrX; PFAM: PF00072, PF00158, PF02954; SUPERFAMILY: SSF52172, SSF52540; COG: COG2204; sigma factor 54 Dshi:1.637..1.639 Mbp (1.416 kbp) score=10
ntrC SWISSPROT P10577: Nitrogen assimilation regulatory protein; COG: COG2204 - Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains; PFAM: PF02954, PF00072, PF00158; SUPERFAMILY: SSF52172; sigma factor 54 Dshi:1.641..1.642 Mbp (1.365 kbp) score=10
rpsI forms a direct contact with the tRNA during translation Dshi:1.666..1.667 Mbp (495 bp) score=10
hemK SWISSPROT P0ACC1: Protein methyltransferase hemK; TIGRFAM: TIGR00536 HemK family putative methylases; COG: COG2890 - Methylase of polypeptide chain release factors; PFAM: PF08241; PROSITE: PS00092; SUPERFAMILY: SSF53335 Dshi:1.799..1.8 Mbp (825 bp) score=10
ilvH with IlvI catalyzes the formation of 2-acetolactate from pyruvate, the small subunit is required for full activity and valine sensitivity; E.coli produces 3 isoenzymes of acetolactate synthase which differ in specificity to substrates, valine sensitivity and affinity for cofactors; also known as acetolactate synthase 3 small subunit Dshi:1.85..1.851 Mbp (573 bp) score=10
Dshi_2063 PFAM: PF00092; SMART: SM00327; PROSITE: PS50234; PRINTS: PR00453; related to von Willebrand factor type A Dshi:2.185..2.186 Mbp (756 bp) score=10
efp elongation factor P Dshi:2.218..2.219 Mbp (642 bp) score=10
tig trigger factor Dshi:2.317..2.318 Mbp (1.329 kbp) score=10
nusB Swiss-Prot: Q0APG4-N utilization substance protein B homolog TIGRFAM: transcription antitermination factor NusB PFAM: NusB/RsmB/TIM44 Dshi:2.371..2.371 Mbp (480 bp) score=10
Dshi_2267 IPR002035: von Willebrand factor, type A Dshi:2.391..2.393 Mbp (1.662 kbp) score=10
moeA2 Swiss-Prot: P12281 - Molybdopterin biosynthesis protein TIGRFAM: molybdenum cofactor synthesis domain PFAM: molybdopterin binding domain; MoeA domain protein domain I and II; MoeA domain protein domain IV Dshi:2.401..2.402 Mbp (1.272 kbp) score=10
Dshi_2351 IPR003777 / pfam02625 XdhC and CoxI family protein COG1975: Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family; related to XdhC and CoxI family Dshi:2.484..2.485 Mbp (990 bp) score=10
Dshi_2428 Swiss-Prot: P0AGB6-RNA polymerase sigma-E factor rpoE TIGRFAM: RNA polymerase sigma-70 PFAM: sigma-70 region 2 domain protein; sigma-70 region 4 domain protein; Sigma-70 region 4 type 2; sigma-24 subunit, ECF subfamily Dshi:2.569..2.57 Mbp (537 bp) score=10
Dshi_2515 Swiss-Prot: P0AFR2-Putative sulfate transporter ychM TIGRFAM: sulfate transporter PFAM: Sulfate transporter/antisigma-factor antagonist STAS; sulphate transporter KEGG: sit:TM1040_3648 sulfate permease Dshi:2.679..2.68 Mbp (1.737 kbp) score=10
gcvH part of multienzyme complex composed of H, L, P, and T proteins which catalyzes oxidation of glycine to yield carbon dioxide, ammonia, 5,10-CH2-H4folate and a reduced pyridine nucleotide; protein H is involved in transfer of methylamine group from the P to T protein; covalently bound to a lipoyl cofactor Dshi:2.842..2.843 Mbp (369 bp) score=10
cobT1 Swiss-Prot: P29934-Aerobic cobaltochelatase subunit cobT TIGR01651: cobaltochelatase, CobT subunit PFAM: Cobalt chelatase CobT subunit SMART: von Willebrand factor type A Dshi:2.88..2.881 Mbp (1.875 kbp) score=10
Dshi_2740 PFAM: herpesvirus transcription activation factor; related to transactivator Dshi:2.902..2.904 Mbp (1.947 kbp) score=10
gltX Charges one glutamine molecule and pairs it to its corresponding RNA trinucleotide during protein translation Dshi:2.909..2.911 Mbp (1.323 kbp) score=10
gltX Charges one glutamine molecule and pairs it to its corresponding RNA trinucleotide during protein translation Dshi:2.909..2.911 Mbp (1.323 kbp) score=10
Dshi_2905 PFAM: PF01882; COG: COG1721 - Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain); related to DUF58 Dshi:3.064..3.065 Mbp (903 bp) score=10
rpsD primary rRNA binding protein; nucleates 30S assembly; involved in translational accuracy with proteins S5 and S12; interacts with protein S5; involved in autogeneously regulating ribosomal proteins by binding to pseudoknot structures in the polycistronic mRNA; interacts with transcription complex and functions similar to protein NusA in antitermination Dshi:3.108..3.109 Mbp (621 bp) score=10
xdhC TIGRFAM: TIGR02964 xanthine dehydrogenase accessory protein XdhC; PFAM: PF02625; COG: COG1975 - Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family Dshi:3.126..3.126 Mbp (963 bp) score=10
rpsO primary rRNA binding protein; helps nucleate assembly of 30S; binds directly to the 16S rRNA and an intersubunit bridge to the 23S rRNA; autoregulates translation through interactions with the mRNA leader sequence Dshi:3.158..3.158 Mbp (270 bp) score=10
rbfA ribosome-binding factor A Dshi:3.21..3.21 Mbp (408 bp) score=10
mobA in Escherichia coli MobA links a guanosine 5'-phosphate to molydopterin to form molybdopterin guanine dinucleotide during molybdenum cofactor biosynthesis Dshi:3.45..3.45 Mbp (636 bp) score=10
moeA3 TIGRFAM: molybdenum cofactor synthesis domain; molybdopterin-guanine dinucleotide biosynthesis protein B PFAM: molybdopterin binding domain; molybdopterin-guanine dinucleotide biosynthesis MobB region; MoeA domain protein domain I and II; MoeA domain protein domain IV KEGG: sil:SPO0310 molybdopterin biosynthesis protein MoeA rde:RD1_3407 moeA; molybdopterin biosynthesis protein, putative Dshi:3.45..3.452 Mbp (1.773 kbp) score=10
Dshi_3342 PFAM: Class I peptide chain release factor KEGG: rde:RD1_0366 peptidyl-tRNA hydrolase, putative Dshi:3.509..3.509 Mbp (423 bp) score=10
flaF acts as an activator of flagellin translation and may be required for filament secretion or assembly; Bradyrhizobium has one thick flagellum and several thin flagella; the Bradyrhizobium protein in this cluster is associated with the thick flagellum Dshi:3.533..3.533 Mbp (372 bp) score=10
rpsT binds directly to the 16S rRNA and is involved in post-translational inhibition of arginine and ornithine decarboxylase Dshi:3.544..3.544 Mbp (267 bp) score=10
cycK TIGRFAM: cytochrome c-type biogenesis protein CcmF PFAM: cytochrome c assembly protein KEGG: mag:amb4200 cytochrome c biogenesis factor Dshi:3.589..3.591 Mbp (1.995 kbp) score=10
rho transcription termination factor Rho Dshi:3.634..3.636 Mbp (1.272 kbp) score=10
grpE PFAM: GrpE protein KEGG: jan:Jann_0208 GrpE protein; HSP-70 cofactor Dshi:3.646..3.646 Mbp (594 bp) score=10
nusA transcription elongation factor NusA Dshi:3.746..3.748 Mbp (1.635 kbp) score=10
Dshi_3775 TIGRFAM: cytochrome c-type biogenesis protein CcmF; PFAM: cytochrome c assembly protein; KEGG: mag:amb4200 cytochrome c biogenesis factor Dshi:3.963..3.965 Mbp (2.001 kbp) score=10
Dshi_4021 replication initiation protein RepC Dshi:4.221..4.222 Mbp (1.236 kbp) score=10
Dshi_4051 TIGRFAM: cytochrome c-type biogenesis protein CcmF; PFAM: cytochrome c assembly protein; KEGG: mag:amb4200 cytochrome c biogenesis factor Dshi:4.244..4.246 Mbp (2.001 kbp) score=10
Dshi_4102 replication initiation protein RepC Dshi:4.29..4.291 Mbp (1.212 kbp) score=10
Dshi_4156 PFAM: sigma-54 factor interaction domain-containing protein; helix-turn-helix Fis-type; GAF domain protein; KEGG: acr:Acry_2975 GAF modulated sigma54 specific transcriptional regulator, fis family Dshi:4.348..4.35 Mbp (1.749 kbp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70